SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016055 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016055
Domain Number 1 Region: 392-600
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.12e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.0000895
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016055
Domain Number - Region: 263-382
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00128
Family PLC-like (P variant) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016055   Gene: ENSMPUG00000016160   Transcript: ENSMPUT00000016299
Sequence length 735
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:8384829:8393402:-1 gene:ENSMPUG00000016160 transcript:ENSMPUT00000016299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPLLRKTFSRLRGREKLPRKKSDAKERGRPAQRPEPNPPEPEPQAPEGSQAGAEGPPS
PEASRSPARGAYLQSLEPSSRRWVLGGAKPPEEAALGARAPGSGEPAGEIWYNPIPEEDS
RPPAPEPLGPQPGSAEPEGPASQATAPASPPTKASRTKSPGPARRLSMKMKKLPDLRRRL
SLRGTRAGRERERAAPEGSVISRYHLDSSVGTPGRAAGAGATRGPRAGYLSDGDSPERPA
GPPSPTAFRPYEVGTSARTPPAALWGRLSLHLYGLGGLRPAPGATPRDLCCLLQVDGVAR
ARTGPLRGGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTVFRGC
QAQQLAVRLEPQGLLYAKLTLSEQQEAPGTTEPRVFGLPLPLLVERENPPGQVPLIIQKC
VGQIERRGLRVVGLYRLCGSAAVKKELRDDFERDSAAVCLSEDLYPDINVITGILKDYLR
ELPTPLITQPLYQVVLEAMAQGPPSRAPSSTEGTRGLLNCLPDVERATLTLLLDHLRLVS
SFHAHNRMTPQNLAVCFGPVLLPARQAPARPRIRSSGPGLTNAVDFKRHIEVLHYLLQAW
PDPRGAPAPPDLAPYLRPKRQPPLHLPLSGPEVVARPRGRGGPESPPSNRYAGDWSVCGR
DFLPCGRDFLSGPDYDHVTGSYSEDEDEEAGEPAGAADFEDDFEAPFNPHLNLKDFDALI
LDLERELSKQINVCL
Download sequence
Identical sequences M3YXJ5
XP_004761199.1.14098 ENSMPUP00000016055 ENSMPUP00000016055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]