SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016091 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016091
Domain Number 1 Region: 150-401
Classification Level Classification E-value
Superfamily VPS9 domain 4.18e-87
Family VPS9 domain 0.000000000268
Further Details:      
 
Domain Number 2 Region: 32-83
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000641
Family A20-like zinc finger 0.0000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016091   Gene: ENSMPUG00000016195   Transcript: ENSMPUT00000016335
Sequence length 506
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896979.1:7697865:7730954:-1 gene:ENSMPUG00000016195 transcript:ENSMPUT00000016335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQHDLLIYLISRKKMSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKA
RQKQIQEDWELAERLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFS
ASSRVGSKKAEIQEAKAPSPSINRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKMFLE
TMHYKRDLSIEEQSECTQDFYQNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFC
PETTDDEKKDLAIQKRIRALHWVTPQMLCVPVNEEISEVSDMVVKAITDIIEMDSQRVPR
DKLACITRCSKHIFNAIKITRNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPS
RLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQESENWSPDACL
GVKQMYKNLDLLSQLNERQERIMSEARKLEKDLIQWTDGVAKEVQDIVEKYPLEIKPPNQ
PLAAIDSENVENDKLPPPLQPQVYAG
Download sequence
Identical sequences M3YXN1
ENSMPUP00000016091 ENSMPUP00000016091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]