SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016101 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016101
Domain Number 1 Region: 304-519
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-51
Family DBL homology domain (DH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 821-1119
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000003
Family WD40-repeat 0.024
Further Details:      
 
Domain Number 3 Region: 532-615,709-767
Classification Level Classification E-value
Superfamily PH domain-like 0.000000032
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016101   Gene: ENSMPUG00000016205   Transcript: ENSMPUT00000016345
Sequence length 1280
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:27217202:27318072:-1 gene:ENSMPUG00000016205 transcript:ENSMPUT00000016345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSPPPQTATGDQLVPGGPGPSPEAEDDPGEAFEFDDSDDDEDTSAGLGVPGVAPEKD
IEDAPLIHLDSAPITDPDPAASPPQTQVPPVVSNGDAVDAALSGVRRSSWKRKSSRRIDR
FTFPALEEDVIYDDVPCENLDAHQPGVERNLLYEDVHRDGAPREADDLGWSSSEFESYSE
DSGEETKPEAEPAKHRVSFQPKLSPDLTRLKERCARTKRDILALRAGGRDMQALKHKCDC
KMTQLMRAAKSGTKDGLEKTRIAVMRKVSFLHRKDVLGDSEEEDMGLLEVSVTDIKPPAP
ELGPMPDGLSPQQVVRRHILGSIVQSEGSYVESLKRVLQDYRNPLIEMEPKVLSARKCQA
VFFRVKEILHCHSMFQIALSSRVAEWDATEKIGDLFVASFSKSMVLDVYSDYVNNFTNAM
SIIKKACLTKPAFLEFLKRRQVCSPDRVTLYGLMVKPIQRFPQFILLLQDMLKNTPRGHP
DRLSLQLALTELETLAEKLNEQKRLADQVAEIQQLTKSVSDRSSLNKLLTSGQRQLLLCE
TLTETVYGDRGQLIKSKERRVFLLNDMLVCANINFKPANNRGQLEISSLVPLGPKYVVKW
NTALPQVQVVEVGQESGSYDKDNVLIQHAGAKKASAVGQAQNKVYFGPPRLFQELQDLQK
DLAVVEQITFLISTLHGTYQNLNMTVAQDWCLALQRLMRVKEEEIHSANKCRLRLLLPGK
PDKSGRPISFMVVFITPNPLSKISWVNRLHLAKIGLREENQPGWLCPDEDKKSKGPFWCP
ILACCIPAFSSRGLSLQLGALVHSPVSCPLLGFSAVSTSLPQGYLWVGGGQEGAGGQVEI
FSLNRPSPRTVKSFPLAAPVLCMEYIPEPEEGENGDESRMAPDPSTTVHPTICLGLQDGS
ILVYGSVDTGTQCLATCRSPSLQPVLCLCHSPFHLFAGLQDGTLAAYPRTSGGVPWDLES
PPVCLTVGTGPIRTLLSLEDAVWASCGPRVTVVDATSLQTQQSFEAHQDETVSVTHMVKA
GSGVWMAFSSGSSIRLFHTETLEHLQEINIATRTTFLLPGQKHLGVTSLLICQGLLWVGT
DQGVIVLLPVPRLEGIPKITGKGMVSLNGHCGPVAFLAVATSILAPDILRSDQEEAEGSQ
AEEDKLDGPAPEPTPTPASHVGRELTRKKGVLLQYRLRSTAHLPGPLLSVREPTPADASA
LEHSEEDGSIYEMADDPDVWVRSRPCTRDAHRKEICSVAIISGGQGYRNFGSAPPGGSGR
PAPCGETDSALLIWQVPLTL
Download sequence
Identical sequences M3YXP1
XP_004741407.1.14098 XP_004741408.1.14098 XP_004741409.1.14098 XP_004741410.1.14098 XP_004741411.1.14098 ENSMPUP00000016101 ENSMPUP00000016101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]