SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016109 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016109
Domain Number 1 Region: 23-117
Classification Level Classification E-value
Superfamily SH3-domain 6.93e-16
Family SH3-domain 0.00037
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016109
Domain Number - Region: 662-769
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00123
Family Myosin rod fragments 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016109   Gene: ENSMPUG00000016213   Transcript: ENSMPUT00000016353
Sequence length 1333
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897077.1:95818:175147:-1 gene:ENSMPUG00000016213 transcript:ENSMPUT00000016353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVELGVHRTLLLVISLTKCLEGTKLLADLKKCGDLECETLISRVLAMRDYRGPDCRYLNF
TKGEEISVYVKLAGEREDLWAGSKGKDFGYFPRDAVQIEEVFISEEVEISTKESDFLCLL
GVSYTFENEDSELNSDDDKNIYLYEEDKDQKSSVYESDFQTESGFYSASESTLFEDQFPS
SEAPEDIRSTSESKDWEELDAGSMKEDSLPEVDHIPLSSAEVKGWFGFGRELAEGNTFES
VIEPLQESSFQSRKIAGEDENDLEELNNDEPQTEQKQEPELEFDLVPKKQSELGSESENI
NSPEATSWFGGGFQSYLGFGGEDTGLELLSKGSNPPLQDVPNSISSEEEPTVPCTEILTE
KEDAIANDTSILKPSWFDFGFGMLGFVYTNEDKIISDDGKSEEGYGGDEHEQLPTSKFDP
DKEQEIETREIMETEDQVSKERAPEKTDDSDTLPYFKKFLYNLDSPWNFQDIPKETELPF
SEQIQDEDNVIENDETEQFSAENYHTDNMKAMMLKSIYKLTEDASECWILKYLFQIDICD
FMSSAFSPIIILTERVLVGVPEDMRPNSYGFPWELVICAGVFGFFAVLLFLWRSFRSVRS
RLYVGRENKLAVELSTLIDEKCKLLEKLSLVQKEYEGLESSLKDASFEKESTEAQSLETV
CETLNKTKSELEDEILVLENQLEEEKSLHSEQDELMVDISKTIQSLEDESDSLKSQVAEA
KTTFRVFQMNEERLKIALKDALSENSQLEESQKQLLQEAEELKEQVNELNKQKIAFEDFN
VDAEQVLCDKEINIKSLTERLIKMKDWTAVLGEDIANDDNLDLEMNESENGMIIDNQPKG
ALKTLVHAAKLKTSLKTLEGERNQIYIQLSEVDKTKEELTEYLESLQTEQASLQSENIQF
ESENQKLQQKLKVMTELYQENEMTLHRKLTVEENYRLEKEGKLSKADEKISHAFEELETY
RKRAKDLEEELERTVHSYQGQIISYEKKAHDNWLAARNAERALNELRKENAYNRQKLTET
EFKFELLEKDPYALDVPNTAFGREHSPYGPSPLGRPSSETRAFLSPPTLLEGPLRLSPLL
PGGGGRGIRGPGNPLDHQNTNERGDSNCDRLTDARRAPSDTGSLSPPWEQDRRMMIPPSG
QPYPDPAIPPQRQDRFYSTSGRLSGPAELRSINMPSSDKVDGPISSEMESTRNDNKDDLG
NLNVPDSSLPAKSEAAGPGFVPPPLAPFRAPLFPMDARGPFMRRGPPFPPPPPGSMYGAP
RDYFPPRDFAGPPPPPFAMRNVYPPRAFPPFLPPRAGFFPPPPRAENRCEFPLGLTPPSN
EPTTEHPAPQQET
Download sequence
Identical sequences M3YXP9
ENSMPUP00000016109 ENSMPUP00000016109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]