SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016124 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016124
Domain Number 1 Region: 21-360
Classification Level Classification E-value
Superfamily Phosphofructokinase 8.76e-110
Family Phosphofructokinase 0.000000206
Further Details:      
 
Domain Number 2 Region: 349-770
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.31e-106
Family Phosphofructokinase 0.00000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016124   Gene: ENSMPUG00000016228   Transcript: ENSMPUT00000016368
Sequence length 790
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896959.1:2608199:2663596:1 gene:ENSMPUG00000016228 transcript:ENSMPUT00000016368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDDEVANRKVSFRKCLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGRNIVEASWESVSSILQVGGTIIGSARCKAFRTREGRLKAAQNLVQRGIT
NLCVIGGDGSLTGANIFRKEWSGLLEELAQNGEIDKEQVQKHAYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWQEDMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEQIKELVVKQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATPETPACVVSLSGNQAVRLPLVEC
VQMTQDVQKAMDERRFKDAVQLRGRSFETNLNTYKRLAIKLPDDQIVKSNCNVAVINVGA
PAAGMNAAVRSAVRVGIADGHKMLAIYDGFEGFAKGQIKEIGWGDVGGWTGQGGSILGTK
RTLPGKSLEDIAAQMRTHSINALLIIGGFEAYLGLLELSAARDRYEELCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWISTKLKEAPGKGKRFTSEDSICVL
GISKRNLLFQPVTQLRKDTDFEHRIPKEQWWLKLRPLMKILAKYKASYEVSESNQLEPVH
PRGHEEPAAI
Download sequence
Identical sequences M3YXR4
ENSMPUP00000016124 XP_004757964.1.14098 ENSMPUP00000016124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]