SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016164 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016164
Domain Number 1 Region: 1693-2019
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.01e-89
Family Rap/Ran-GAP 0.00018
Further Details:      
 
Domain Number 2 Region: 1064-1442
Classification Level Classification E-value
Superfamily ARM repeat 0.000000288
Family Exportin HEAT-like repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016164   Gene: ENSMPUG00000016268   Transcript: ENSMPUT00000016408
Sequence length 2038
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897077.1:3246964:3490032:1 gene:ENSMPUG00000016268 transcript:ENSMPUT00000016408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSKKPHGDVKKSTQKVLDTKKDALTRLKHLRIVIENAESIDLKQFFDQHFSHIYYVFFE
NFVTIEASLKQKGHKSQREELDAILFIFEKILQLLPERIHQRWQFHSIGLILKKLLHTGN
SLKIRREGVRLFLLWLQALQNNCSKEQLWMFSCLIPGFSALQSEHGPRTLDNLINPPLNL
QETQVTIEEITPLVPPQSGDKGQEDLTSYFLEALLKYIVIQVKSLEWKNKENQERGFSFL
FSHFKKYYLPYIFPNICKENSLYHPVLDIPQVRPKPHYVMIKKDAETNEAIYCTKEPFIK
ARVIVIRWLVSFWLEPKPHTGPHIPGMEGEVLPKNIQRAAASLVSREENKNDNADKADRA
TEPEQSHSNTSTLTEREPSSSSLCSIDEEHLTDIEIVRRVFSSKRSNVNFVTEIFRQAFL
LPICEAAAMRKVVKVYQEWIQQEEKPLFMQEPEEIVISSSDLPCIDNVTDHVISMEEGEK
REEVNCSNTLKGVNQINWVREMRNWRHLKNVQKKSDHRSMRLKRKAVIIVFIINSSNIFL
LEPANEIKNLLDEHTDMCKRILNIYRFMVVQVSMDKKTWEQMLLVLLRVTESVLKMPSQA
FLQFQGKKNMTLAGRLAGPLFQTLIVAWIKANLNVYISRELWDDLLSVLSSLTYWEELAT
EWSLTMETLTKVLARNLYSLDLSDLPLDKLSEQKQKKHKGKGVGHEFQKVSVDKSFSRGW
SRDQPGQAPMRQRSATTTGSPGTEKARSIVRQKTVDIDDAQILPRPTRVRHFSQSEDTGN
EVFGALNEEQPLPRSSSTSDILEPFTVERAKVNKEDMSPKLPPLNSDIGSSSANVPDLMD
EFIAERLRSGNASTMTRRGSSPGSLEIPKDLPDILNKQNQMRPIDDPGVPSEWTSPASAG
SSDLISSDSHSDSFSAFQYDGRKFDNFGFGADAGITSSADVDSGSGHHQSAEEQEVASLT
TLQIDSETSSLNQQAFSAEVATVTGSESASPVHSALGSRSQTPSPSTLNIDNMEQKDLQL
DEKLHHSVLQTPDDLEISEFPSECCSVMAGGTLTGWHADVATVMWRRMLGILGDVNAIMD
PEIHAQVFDYLCELWQNLAKIRDNLGISTDNLTSPSPPVLIPPLRILTPWLFKATMLTDK
YKQGKLHAYKLICNTMKRRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFF
SLGLPGATMLIMDFIVAAGRVASSAFLNAPRVEAQVLLGSLVCFPNLYCELPALHPNIPD
IAVSQFTDVKELIIKTVLSSASMSVSGHAKCVALCSLGIWICEELVHESHHPQIKEALNV
ICVSLKFTNKTVAHVACNMLHMLVHYVPRLQIYQPDSPLKIIQILIATITHLLPSTEASS
YEMDKRLVVSLLLCLLDWIMALPLKTLLQPVHATGAENDKIEKSVLNCIYKVLHGCVYGA
QCFSNPRYFPMSLSDLASIDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQQG
LISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSESTELSPELFESPNIQFF
VLNNTTLVSCIQIRSEESIPGGGLSAGLASANSNVRIIVRDLSGKYSWDSAILYGPPPVS
GLSEPTSFILSLSRQEKPEEPPTSNECLEDITVNDGISLQFKRGFRETVPTWDTIRDEED
VLDELLQYLGITSPECLQRTGISLNIPAPQPVCISEKQENDVINAILKQHTEEKEFVEKH
FNDLNMKAVEQDEPTPQKPQSAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNL
DSRQCRETHKIAVFYVAEGQEDKHSILTNTGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQ
KNKSTGLTTPYFATSTVEVIFHVSTRMPSDNDDSLTKKLRHLGNDEVHIVWSEHTRDYRR
GIIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRATAINA
SRALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVFSPAPYHHLPSDAGDH
Download sequence
Identical sequences M3YXV4
ENSMPUP00000016164 ENSMPUP00000016164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]