SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016192 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016192
Domain Number 1 Region: 372-571
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-49
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 711-774
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-16
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 3 Region: 571-696
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000252
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016192   Gene: ENSMPUG00000016295   Transcript: ENSMPUT00000016436
Sequence length 796
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:28050890:28060262:1 gene:ENSMPUG00000016295 transcript:ENSMPUT00000016436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCGPPATLPSHLAGPRGTDRRPVAVCQQESLSFAELPTLQPPSPVCLDLFPVAPEELRA
PGSRWSLGTPTPLQGLPWPPSPEVPDTEISTSGGLRPSRAGSWPHCPSAQPQALEGPWSP
QHPQPQRRASHGSEKKSAWRKMRVYQREELPGSPGAHAVFLEPGQAAEQTLSTEEPRPPE
LSLPSRVGLEGPERRRFSASELMTRLHSSLRLGRNSAARVLTPGSGTGAAREGRSSGRES
RSVEMRVDGLVMPAPIDPSGCHSGWPEPRLYTPEELALGSRSSSERRQSRFLLNSTWDEG
AGGGGAGPAEVGPRKRGPGGAEPSGEETPSGRRTERARLGGAGPMGGARGSTPQSRSSGG
PVQPFRSRLPLTQAKFELITSEASYIHSLSVAVGHFLGSAELSECLGVQDKQWLFSKLPE
VKSTSERFLQDLEQRLEADVLRFSVCDIVLHHCPAFRRVYLPYVTNQAYQERTYQRLLLE
NPKFPGILARLEESPVCQRLPLTSFLILPFQRITRLKMLVENILKRTAQGSEDEDMATRA
FNALKELVQECNASVQSMKRTEELIHLSKKIHFEGKIFPLISQARWLVRHGELVELAPLP
AAPPAKLKLSSKAVYLHLFNDCLLLSRRKELGKFAVFVHARMAELQVKDLSRKLQGVPGH
VFLLQLLHGPHAKHQFLLRARTESEKQRWISALCPSSSQEDKEFFSEGQDRPQVQCVRTY
KALQPDELTLEKTDILAVRTQTSDGWLEGVRLADGEKGWVPQAYVEEISSLSARLRNLRE
NKRITSAPSKLGEPPA
Download sequence
Identical sequences M3YXY2
ENSMPUP00000016192 ENSMPUP00000016192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]