SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016203 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016203
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 9.52e-54
Family Cofilin-like 0.000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016203   Gene: ENSMPUG00000016306   Transcript: ENSMPUT00000016447
Sequence length 166
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897077.1:4193219:4195132:1 gene:ENSMPUG00000016306 transcript:ENSMPUT00000016447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI
GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Download sequence
Identical sequences A0A096NLX4 A0A0P6JD92 A0A250XVI3 A0A286XW45 A0A2K5BUX0 A0A2K5IV02 A0A2K5SF15 A0A2K5XDU9 A0A2K6D738 A0A2K6ESE2 A0A2K6QBL4 A0A2K6S5S9 B2CZR7 F7DMB4 G1QT84 G3QVF0 G7MXF7 G7PA25 H2NL04 H2Q860 J9P2G7 M3W9N7 M3YXZ3 Q148F1 Q549N0 Q5G6V9 Q9Y281
ENSGGOP00000006717 9598.ENSPTRP00000010615 9600.ENSPPYP00000006519 9606.ENSP00000298159 9823.ENSSSCP00000002141 9913.ENSBTAP00000020036 ENSPPYP00000006519 ENSPVAP00000002641 ENSSSCP00000002141 ENSPANP00000013982 ENSCJAP00000011822 ENSCJAP00000011824 ENSMPUP00000016203 ENSMPUP00000016203 ENSCAFP00000039744 ENSNLEP00000004152 ENSSSCP00000002141 gi|14719392|ref|NP_068733.1| gi|33946278|ref|NP_619579.1| ENSP00000298159 ENSP00000340635 ENSVPAP00000003028 ENSCJAP00000011822 ENSGGOP00000006717 ENSGGOP00000019559 ENSPTRP00000010616 ENSP00000298159 ENSVPAP00000003028 ENSBTAP00000020036 ENSP00000298159 ENSP00000340635 ENSPPYP00000006519 ENSNLEP00000004152 NP_001020386.1.46622 NP_001069622.1.59421 NP_001069622.1.76553 NP_001248113.1.72884 NP_001271889.1.63531 NP_068733.1.87134 NP_068733.1.92137 NP_619579.1.87134 NP_619579.1.92137 XP_002753857.1.60252 XP_002824710.1.23681 XP_003263746.1.23891 XP_003263747.1.23891 XP_003314409.1.37143 XP_003471939.2.53824 XP_003821246.1.60992 XP_003924261.1.74449 XP_003924262.1.74449 XP_004055117.1.27298 XP_004055118.1.27298 XP_004270006.1.21590 XP_004376578.1.4749 XP_004399869.1.74151 XP_004436472.1.5094 XP_004773409.1.14098 XP_004867629.1.39548 XP_005603491.1.31192 XP_005656356.1.46622 XP_006186447.1.101512 XP_006212829.1.17985 XP_006732293.1.47382 XP_006835418.1.41390 XP_007464872.1.90284 XP_007464873.1.90284 XP_007936733.1.48129 XP_007984652.1.81039 XP_007984653.1.81039 XP_008511191.1.77740 XP_009004169.1.60252 XP_009247290.1.23681 XP_010375675.1.97406 XP_010375676.1.97406 XP_010375677.1.97406 XP_010586888.1.64505 XP_010966149.1.22495 XP_010984445.1.51371 XP_011281488.1.62641 XP_011375087.1.92234 XP_011375096.1.92234 XP_011375105.1.92234 XP_011733170.1.29376 XP_011733171.1.29376 XP_011814840.1.43180 XP_011850447.1.47321 XP_011986157.1.54773 XP_012324260.1.9421 XP_012324269.1.9421 XP_012513704.1.63892 XP_012591948.1.48125 XP_013365831.1.28644 XP_014690251.1.49734 XP_014957490.1.66739 XP_014999013.1.72884 XP_015308705.1.63531 XP_016007556.1.101085 XP_017203747.1.1745 XP_017369063.1.71028 XP_017369064.1.71028 XP_017921895.1.57651 XP_019281721.1.44245 XP_019779603.1.83887 XP_020031164.1.5219 XP_020726102.1.74333 XP_021551065.1.83697 XP_509898.2.37143 XP_547771.2.84170 ENSPTRP00000010616 ENSPVAP00000002641 ENSCAFP00000039744 ENSBTAP00000020036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]