SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016204 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016204
Domain Number 1 Region: 37-176
Classification Level Classification E-value
Superfamily PX domain 0.00000000000139
Family PX domain 0.01
Further Details:      
 
Domain Number 2 Region: 211-408
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000126
Family BAR domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016204   Gene: ENSMPUG00000016307   Transcript: ENSMPUT00000016448
Sequence length 412
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897077.1:4254189:4317459:1 gene:ENSMPUG00000016307 transcript:ENSMPUT00000016448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APGPATPQEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDKVKFTVHTKS
SLPNFKQNEFSVVRQHEEFIWLHDSFIENEDYAGYIIPPAPPRPDFDASREKLQKLGEGE
GSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRKDLNFHVFLEYNQDLS
VRGKNKKEKLEDFFKNMVKSADGVIVSGVKDVDDFFEHERTFLLEYHNRVKDASAKSDRM
TRSHKSAADDYNRIGSSLYALGTQDSTDICKFFLKVSELFDKTRKIEARVSADEDLKLSD
LLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQKFEKI
SESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVLNGDT
Download sequence
Identical sequences M3YXZ4
ENSMPUP00000016204 ENSMPUP00000016204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]