SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016218 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016218
Domain Number 1 Region: 102-313
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-54
Family DBL homology domain (DH-domain) 0.0000768
Further Details:      
 
Domain Number 2 Region: 330-446
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-20
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016218   Gene: ENSMPUG00000016321   Transcript: ENSMPUT00000016462
Sequence length 542
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896959.1:4343016:4354979:1 gene:ENSMPUG00000016321 transcript:ENSMPUT00000016462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHDEVGGLLPIKRTIRVLDVSSPTFREQEEPSNKRVRPLARVTSLANLISPVRNGAVR
RFGQTIQSFTLRGDSRSPASAQKLSSRSTVPTPAKRRSSVLWSEMLDVNMKESLTTKEIK
RQEAIYEMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDAYIPLHEDLLA
RIGEATKPGGTVEQIGHILVNWLPGLNAYKGYCSNQLAAKALLDQKKQDPRVQDFLQRCL
ESPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHPDVQPLEEAILIIQGVLSDIN
LKKGESECQYYIDKLEYLDEKQKDPRIEASKVLLCHGELKNKSGHKLYIFLFQDILVLTR
PVTRNERHFYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSDKAKNIFRVRFQDPS
PGQSHTLQANDVFHKQQWFNCIRAAIAPFQQAAGPAEPQGLPELHEEGEENSPSAVNVRA
QRRVSTASSVTQVQGAGDASESGCPGHTAEDMKSAKVRQTQPGLRKARDRAQVDGKRKET
LV
Download sequence
Identical sequences M3YY08
ENSMPUP00000016218 ENSMPUP00000016218 XP_004757980.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]