SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016234 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016234
Domain Number 1 Region: 4-333
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.46e-54
Family GDI-like N domain 0.00000000098
Further Details:      
 
Domain Number 2 Region: 367-412
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.52e-16
Family GDI-like N domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016234   Gene: ENSMPUG00000016337   Transcript: ENSMPUT00000016478
Sequence length 423
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896959.1:4625135:4645712:-1 gene:ENSMPUG00000016337 transcript:ENSMPUT00000016478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGAPPASMGRGRDWNVDLIPKFLM
ANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRK
FLVYVANFDENDARTFEGIDPKKTAMREVYKKFDLGQDVIDFTGHALALYRTDDYLDQPC
CETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQD
GKVIGVKSEGEVARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIP
QNQVNRKSDIYVCMISSAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVS
ISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKRKKNDIY
GED
Download sequence
Identical sequences M3YY24
ENSMPUP00000016234 ENSMPUP00000016234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]