SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016259 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016259
Domain Number 1 Region: 377-683
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.18e-96
Family Protein kinases, catalytic subunit 0.0000000000155
Further Details:      
 
Domain Number 2 Region: 2-123
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.45e-23
Family PLC-like (P variant) 0.0000296
Further Details:      
 
Domain Number 3 Region: 215-285
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.02e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00017
Further Details:      
 
Domain Number 4 Region: 143-211
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.45e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016259   Gene: ENSMPUG00000016362   Transcript: ENSMPUT00000016503
Sequence length 706
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896959.1:5250689:5425292:-1 gene:ENSMPUG00000016362 transcript:ENSMPUT00000016503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPFLRIGLSNFDCGSCQACQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNMDLISETTVELSSLAERCRKNNGKAEIWLELKPQGRMLMNAR
YFLEMSDTKDMSEFETEGFFALHHRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYK
SPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
ARCLRDTEHIFREGPVEIGLPCSIKGEARLPCVPAPGKKEPQGISWESPLDEMEKMCHRP
EPEPNIERPSVHMKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSR
ATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDRDGHIKIADFGMCKENMLGDAKTNTFC
GTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
WLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPYD
CSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFINPGMERLIS
Download sequence
Identical sequences M3YY49
XP_004758000.1.14098 XP_004758001.1.14098 XP_012914561.1.14098 XP_012914562.1.14098 ENSMPUP00000016259 ENSMPUP00000016259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]