SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016298 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016298
Domain Number 1 Region: 311-370
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.55e-18
Family Erythroid transcription factor GATA-1 0.00017
Further Details:      
 
Domain Number 2 Region: 257-309
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.76e-16
Family Erythroid transcription factor GATA-1 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016298   Gene: ENSMPUG00000016402   Transcript: ENSMPUT00000016543
Sequence length 444
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896959.1:6631821:6654808:1 gene:ENSMPUG00000016402 transcript:ENSMPUT00000016543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLGHSYMDPAQYPLPEEVDVLFNIDGQGNHV
PTYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLSAGHSSPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE
KECIKYQVPLPDSMKLESTHSRGSMTTLGGAASTAHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRP
LIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKE
GIQTRNRKMSSKSKKCKKVHDTLEDFPKGSSFNPAALSRHMSSLSHISPFSHSSHMLTTP
TPMHPPSSLSFGPHHPSSMVTAMG
Download sequence
Identical sequences M3YY88
ENSMPUP00000016298 ENSMPUP00000016298 XP_004758015.1.14098 XP_004758017.1.14098 XP_012914573.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]