SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016350 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016350
Domain Number 1 Region: 205-310
Classification Level Classification E-value
Superfamily SMAD/FHA domain 9.39e-29
Family FHA domain 0.00000849
Further Details:      
 
Domain Number 2 Region: 1286-1346,1381-1478
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-25
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 1-60
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000638
Family Motor proteins 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016350   Gene: ENSMPUG00000016453   Transcript: ENSMPUT00000016595
Sequence length 1499
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:32270863:32352416:-1 gene:ENSMPUG00000016453 transcript:ENSMPUT00000016595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAALSPADINYDETLSTLRYADRAKQIKCNAVINEDPNAKLVRELKEEVTRLKDLLRAQ
GLGDIIDIDPLIDDYSGSGGKYLKDFQNNKHRYLLASENQRPGNFSTASMGSLTSSPSSC
SLSSQVGLPSVTSIQERIMSTPGGEEAIERLKESEKIIAELNETWEEKLRKTEAIRMERE
ALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQADAERR
QDIVLSGAHIQEEHCVFRSERNNSGDVIVTLEPCERSETYVNGKRVAQPVQLRSGNRIIM
GKNHVFRFNHPEQARAEREKTPSAETPSEPVDWTFAQRELLEKQGIDMKQEMEKRLQEME
ILYKKEKEEADLLLEQQRLDYESKLQALQKQVETRSLAAETTEEEEEEEEAAWTQHEFEL
AQWAFRKWKSHQFTSLRDLLWGNAVYLKEANAISVELKKKVQFQFVLLTDTLYSPLPPEL
LPTEMEKTHEDRPFPRTVVAVEVQDLKNGATHYWSLEKLRQRLDLMREMYDRAGEVASGS
QDESEATVTGSDPFYDRFHWFKLVGSSPIFHGCVNERLADRTPSPTFSTADSDITELADE
QQDEMEDFDDEAFVDDAGSDAGTEEGSDLFSDGHDPFYDRSPWFILVGRAFVYLSNLLYP
VPLIHRVAIVSEKGEVRGFLRVAVQAIAADEEAPDYGSGIRQSGTAKISFDNEYFNQNDF
SSVAMTRSGLSLEELRIVEGQGQSSEVTTPPEEINRMNDLDLKSGTLLDGKMVMEGFSEE
IGHHLKLGSAFTFRVTVLQASGILPEYADIFCQFNFLHRHDEAFSTEPLKNNGRGSPLGF
YHVQNIAVEVTKSFVEYIKTKPIVFEVFGHYQQHPLHLQGQELSSPPQPSRRFFPPPMPL
SKPVPATKLNTMSKTSLGQSMSKYDLLVWFEISELEPTGEYIPAVVDHTAGLPCQGTFLL
HQGIQRRITVTIIHEKGSELHWKDVRELVVGRIRNKAEVDEAAVDAILSLNIISAKYLKS
SHNSSRLFLDKDIPRTFYRFEAVWDSSLHNSLLLNRVTPYGEKIYMTLSAYLELDHCIQP
AVVTKDVCMVFYSRDAKISPPRSLRSLFGSGYSKSPDSNRVTGIYELSLCKTADTGSPGM
QRRRRKILDTSVAYVRGEENLAGWRPRGDSLILEHQWELEKLELLHEVEKTRHFLLLRER
LGDSIPRSLSDSLSPSLSSGTLSTSTSISSQISTTTFESAITPSESSGYDSADIESLVDR
EKELATKCLQLLTHTFNREFSQVHGSISDCKLSDVSPIGRDPSVSSFSSATLTPSSTCPS
LVDARSNSLEQKTPEANSRASSPCTEFEQFQIVPPVETPYLARAGKNEFLNLVPDIEEIR
PGSVVSKKGYLHFKEPLYSNWAKHFVVVRRPYVFIYNSDKDPVERGVINLSTAQVEYSED
QQAMVKTPNIFAVCTKHRGVLLQALNDKDMNDWLYAFNPLLAGTIRSKLSRRCPSEPKD
Download sequence
Identical sequences M3YYE0
ENSMPUP00000016350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]