SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016370 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016370
Domain Number 1 Region: 625-992
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 9.16e-129
Family Hect, E3 ligase catalytic domain 0.00000000368
Further Details:      
 
Domain Number 2 Region: 45-185
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.7e-32
Family Synaptotagmin-like (S variant) 0.032
Further Details:      
 
Domain Number 3 Region: 209-251
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000473
Family WW domain 0.001
Further Details:      
 
Domain Number 4 Region: 568-607
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000765
Family WW domain 0.00024
Further Details:      
 
Domain Number 5 Region: 404-442
Classification Level Classification E-value
Superfamily WW domain 0.000000000000167
Family WW domain 0.0016
Further Details:      
 
Domain Number 6 Region: 522-556
Classification Level Classification E-value
Superfamily WW domain 0.000000000000415
Family WW domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016370   Gene: ENSMPUG00000016473   Transcript: ENSMPUT00000016615
Sequence length 999
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896913.1:3164839:3479430:1 gene:ENSMPUG00000016473 transcript:ENSMPUT00000016615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRTPLVVAIVTTCGRCCPPGNLHRLQAQGFYWGEGDDSPGESRILRVKVVSGIDLAKKD
IFGASDPYVKLSLYVADENRELALVQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDE
NRLTRDDFLGQVDIPLSHLPTEDPTMERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKN
GGQDEENSEQRDDMEHGWEVVDSNDSASQHQEELPPPPLPPGWEEKVDNLGRTYYVNHNN
RTTQWHRPSLMDVSSESDSNIRQINQEAAHRRFRSRRHISEDLEPEPGEGGDGPEPWETI
SEEVNITGDSLSLSLPPPPSSPGSRTSPQELSEELSRRLQITPDSNGEQFGSLIQREPSS
RLRSCSVTDAVAEQAHLPPPSAPARRARSSTVTGGEEPTPSVAYAHTTPGLPSGWEERKD
AKGRTYYVNHNNRTTTWTRPIVQLAEDGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSA
PLEGAKDSPIRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFI
DHNTKTTTWEDPRLKFPVHMRSKASLNPNDLGPLPPGWEERIHLDGRTFYIDHNSKITQW
EDPRLQNPAITGPAVPYSREFKQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIM
SVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQIN
PNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEY
YNSLKWILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRF
VNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPN
HPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKL
PRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD
Download sequence
Identical sequences M3YYG0
ENSMPUP00000016370 ENSMPUP00000016370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]