SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016389 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016389
Domain Number 1 Region: 71-125
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016389   Gene: ENSMPUG00000016492   Transcript: ENSMPUT00000016634
Sequence length 181
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897102.1:139230:148518:-1 gene:ENSMPUG00000016492 transcript:ENSMPUT00000016634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEISAQEAVGSPVVQFQSLESLSEGLSPEPPFAQDTDMEQELNGAPPVPQVPALPHEGS
PGDQAATLLTARYQEFVTFEDVAVHLTREEWGCLDPVQRDLYREVMLENYGNVVSLGILL
RLPTTRIHSVNSCPALSHTQASAFSGETLAVLSAGISKRWPKYRLPIDIARPRSEAPFPR
L
Download sequence
Identical sequences M3YYH9
ENSMPUP00000016389 XP_004774977.1.14098 ENSMPUP00000016389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]