SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016432 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016432
Domain Number 1 Region: 16-147
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.8e-40
Family Gelsolin-like 0.00000477
Further Details:      
 
Domain Number 2 Region: 612-731
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.75e-37
Family Gelsolin-like 0.0000298
Further Details:      
 
Domain Number 3 Region: 388-524
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.54e-37
Family Gelsolin-like 0.0000316
Further Details:      
 
Domain Number 4 Region: 249-436
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 7.59e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.01
Further Details:      
 
Domain Number 5 Region: 511-611
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.97e-25
Family Gelsolin-like 0.0002
Further Details:      
 
Domain Number 6 Region: 757-827
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 4.19e-23
Family VHP, Villin headpiece domain 0.00011
Further Details:      
 
Domain Number 7 Region: 123-233
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 4.71e-19
Family C-terminal, gelsolin-like domain of Sec23/24 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016432   Gene: ENSMPUG00000016535   Transcript: ENSMPUT00000016677
Sequence length 827
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896989.1:2069498:2093138:1 gene:ENSMPUG00000016535 transcript:ENSMPUT00000016677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKLSAQVKDSLNVTTPGVQIWRIEAMKMVPVPSSTFGSFYDGDCYIVLAIHKTGSNLSY
DIHYWIGQASSQDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKG
GVASGMKQVKTNSYEVRRLLHVKGKRNVVAGEVEVSWNSFNCGDVFLLDLGRIIIQWNGP
EGSRMERLRGMTLAKEIRDQERGGRTYVGVVDGENETESPKLMEIMNHVLGQRGSLKAAV
PDDLVEPAVKAALKLYHVSDSEGKLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKG
KNANAQERTGAMNQALNFIKAKQYPPSTQVEVQNDGAESAVFQQLFQKWTLPNQTSGLGK
THTLGSVAKVEQVKFDATSMHVQPQVAAQQKMVDDGSGEVEVWRIEDLELVPVDSKWLGH
FYGGDCYLLLYTYLIGEKKHYLLYIWQGSQASQDEIAASAYQAVILDQKYNNEPVQIRVP
MGKEPPHLLAIFKGRMVVYQGGTSRANQLEPVPSTRLFQVQGTSANNTKAFEIQPRASSL
NSNDVFILKTQSCCYLWCGKGCSGDEREMAKMVSDNISRTEKQVVVEGQEPASFWVALGG
KAPYASTKRLKEETLAITPRLFECSNQTGRFLATEIPDFNQDDLEEEDVFLLDVWDQVFF
WIGKHANEEEKKAAAITAQEYLKTHPSGRDPETPIIVVKQGHEPPTFTGWFLAWDPFKWN
NTKSYEDLKAELGNSGDWGEITVEITSSKLDTFDVNSNLVSGPLPIFPLEQLVNKPVEEL
PEGVDPSRKEAHLSIEDFTKAFGMTPTAFSALPRWKQQNLKKEKGLF
Download sequence
Identical sequences M3YYM2
ENSMPUP00000016432 ENSMPUP00000016432 XP_004762816.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]