SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016435 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016435
Domain Number 1 Region: 319-463,506-657
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.96e-103
Family Mammalian PLC 0.000000258
Further Details:      
 
Domain Number 2 Region: 133-259
Classification Level Classification E-value
Superfamily EF-hand 1.49e-34
Family EF-hand modules in multidomain proteins 0.0017
Further Details:      
 
Domain Number 3 Region: 664-789
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.07e-29
Family PLC-like (P variant) 0.0001
Further Details:      
 
Domain Number 4 Region: 12-123
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-27
Family Pleckstrin-homology domain (PH domain) 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016435   Gene: ENSMPUG00000016538   Transcript: ENSMPUT00000016680
Sequence length 798
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896989.1:2223448:2239961:1 gene:ENSMPUG00000016538 transcript:ENSMPUT00000016680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLMQGRLPISEDLLLMQKGTLMRKVRSKSWKKLRYFRLQDDGMTVWHARQAGSTAKPT
FSISDVESVREGQESELLRSLAEELPLEQGFTIVFHGRRSNLDLVANSAEEAKIWMQGLQ
LLVDFVTGMDQQERLDQWLSDWFQRGDKNQDGRMSFHEVQRLLHLMNVKMDQEYAFQLFQ
AADTSESGTLEGEEFVEFYKALTKRTEVQELFENFSADGQKLTLLEFVDFLQEEQKEGER
ASDLALELIDRYEPSDSGKRVRAEGHWTCVRRGTLESQLCHPGIYQTNTLQNIIRELMLG
RNPQVVAGSGYTAQGMKHRYLLALKRGCRCVEVDIWDGPNGEPIVYHGHTLTSRIPFKDV
VATVAQYAFQTSDYPVILSLENHCSWEQQQVMAYHLTEILGEQLLSTTLDGLLPTQLPSP
EELRRKILVKGKKLRTLEEDLEEEEEEEELECELETEQEADTELEAHLESVSQELSPRSK
DKKKVVMCPLFCPPICCEVMVQAPISKAGSLLFSKQKSKPILCPSLSALVVYLKSVSFHS
FTHSREHYRFYETSSFSEAKARSLIKEAGNEFVQHNAWQLSRVYPSGLRTDSSNYNPQEL
WNAGCQMGPTVAMNVQTAGLEMDICDGFFRQNGGCGYVLKPDFLRDAQSSFHPERPISPF
KAQTLLIQIISGQQLPKEDTSKERSIVDPLVRVEIFGVRPDKSRQETSYVENNGFNPYWG
QTLSFQVLVPQLALLRFVVEDYNRKSRNDFIGQYTVPWSCMQQGYRHVHLLSKDGISLHP
ASIFVHISIREGPEGDES
Download sequence
Identical sequences M3YYM5
ENSMPUP00000016435 ENSMPUP00000016435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]