SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016451 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016451
Domain Number 1 Region: 354-718
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.7e-126
Family Hect, E3 ligase catalytic domain 0.00000000526
Further Details:      
 
Domain Number 2 Region: 7-132
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.56e-21
Family PLC-like (P variant) 0.043
Further Details:      
 
Domain Number 3 Region: 269-309
Classification Level Classification E-value
Superfamily WW domain 0.000000000000348
Family WW domain 0.00079
Further Details:      
 
Domain Number 4 Region: 225-263
Classification Level Classification E-value
Superfamily WW domain 0.00000000128
Family WW domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016451   Gene: ENSMPUG00000016554   Transcript: ENSMPUT00000016696
Sequence length 725
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897102.1:538954:640392:1 gene:ENSMPUG00000016554 transcript:ENSMPUT00000016696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDWFQTKVSFEILCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHY
DLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDT
DAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDST
AAAAGGGDCRFVESPSQDQRLQAQRLRNPEVRGSLQTPQNRPHGHQSPELPEGYEQRTTV
QGQVYFLHTQTGVSTWHDPRIPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDHNNRTT
QFTDPRLHHIMNHQCQLKEPSQPLPLPSEGSVEDEELPAQRYERDLVQKLKVLRHELSLQ
QPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLC
HEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHFVGRIMGLAVFHGHYINGGFTV
PFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHNAFGRILQHELKP
NGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELELII
GGLDKIDVSDWKSNTRLKHCGADSNIVRWFWQAVETFDEERRARLLQFVTGSTRVPLQGF
KALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEETC
GFAVE
Download sequence
Identical sequences M3YYP1
ENSMPUP00000016451 XP_004775004.1.14098 ENSMPUP00000016451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]