SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016461 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016461
Domain Number 1 Region: 618-732
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000767
Family Pleckstrin-homology domain (PH domain) 0.049
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016461
Domain Number - Region: 989-1067
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00034
Family Regulator of chromosome condensation RCC1 0.031
Further Details:      
 
Domain Number - Region: 207-351
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00288
Family Regulator of chromosome condensation RCC1 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016461   Gene: ENSMPUG00000016564   Transcript: ENSMPUT00000016706
Sequence length 1191
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897102.1:1220493:1240516:1 gene:ENSMPUG00000016564 transcript:ENSMPUT00000016706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSVLWAVDLFGKVYTLSTAGQYWELCKDSQLEFKRVSATTQCCWGIACDNQVYVYVCA
SDVPIRRREEAYENQRWNPVGGFCEKFLPSDRWQWSDVSGLQHRPLDGVALPSRHWEWES
DWYVDENFGGEPTEKGGWTYAIDFPATYTRDKKWNSCVRRRRWIRYRRYRSRDAWAKIPS
KDDPEQLPDPFNDLSVGGWDITDEPVGRLSVWAVSLQGKVWYREDVSHPNPEGSSWSLVD
TPGEAVQISCGPHDLLWVTLWEGQALVREGINRNNPKGSSWSIVEPPAASENGIVHVSVG
VSVVWAITKDRKVWFRRGVNSHNPCGTSWIEMVGDMMMVNVGLNDQVWGIGCEDRAVYFR
QGVTQSELSGKTWKAIVTSRESDRSHSGSSSSLLSAGCFFGDEVRGSGESCAPSDTDASL
EADRPGPDQPVPAESVDSPRNSRDSSASGPGTGRTTERAVEVPGPTTQTSGPEPGPATQT
SGPEPCPGLASSPAELPWTNIDLKEPKRAPGHSAAGFPETTGLSSLGLLPLGLEEPYGAD
DHPLWAWVSGGGCAVEAHAVLKWFTVQSGLSPSVQTHSLSIMPAQTAAWRKQIFQQLTER
TKRELEHFRHYEQAVEQSVWVKTGALQWWCDWKPHKWVDVCVALEQFTGLDGARDSILFI
YYVVHEEKKYLHVFLNEVTVLVPVLNETKHSFALYTPERTRQRWPVRLAAATEQDMNDWL
ALLNLSCCESRRVHGRPSPQAIWSITCKGDIFVSEPSPDLEASEHRLPCDQMFWRQVGGH
LRVVEANSRGVVWGIGYDHTAWVYTGGYGGGCFQGLASSTSNIYTQSDVKCVYIYENQRW
NPVTGYSSRGLPTDRYMWSDASGLHECTKAGTKPPSLQWTWVSDWSVDFSVPGGTDQEGW
QYASDFPASYHGYKTMKDFVRRRCWARKCKLVTSGPWLEVAPIALGDVSIIPESPGADRS
GHIALWAVSDKGDVLCRLGVSELNPAGSSWLHVGTDQPFTSVSIGGCHQVWAVARDGSAF
YRGSVSPTQPAGDCWYHIPSPPKQRLKQVSVGQTAVYALDENGNLWYRQGVTPSYPQGSS
WEHVSNNVCRVSVGPLDQVWIIADKVPGSRSMSRGTVCHRTGVQPREPMGQGWDYGIGGG
WDHITIRANATRALRSRSQETTTDWSGEPGLPSTPSRVAGALHEAHGPVCC
Download sequence
Identical sequences M3YYQ1
ENSMPUP00000016461 XP_004775015.1.14098 ENSMPUP00000016461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]