SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016475 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016475
Domain Number 1 Region: 15-208
Classification Level Classification E-value
Superfamily Sec7 domain 1.31e-79
Family Sec7 domain 0.00000000624
Further Details:      
 
Domain Number 2 Region: 216-337
Classification Level Classification E-value
Superfamily PH domain-like 5.77e-35
Family Pleckstrin-homology domain (PH domain) 0.000000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016475   Gene: ENSMPUG00000016578   Transcript: ENSMPUT00000016720
Sequence length 351
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897102.1:1671747:1753252:-1 gene:ENSMPUG00000016578 transcript:ENSMPUT00000016720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEIDNLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQNSPEDVAQFLYKG
EGLNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRM
MEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFVTMNRGINEG
GDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFIL
TDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADG
RVVEGNHVVYRISAPSPEEKEEWMKSIRASISRDPFYDMLATRKRRIANKK
Download sequence
Identical sequences M3YYR5
ENSMPUP00000016475 ENSMPUP00000016475 XP_021535909.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]