SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016547 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016547
Domain Number 1 Region: 402-578
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.74e-75
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000209
Further Details:      
 
Domain Number 2 Region: 580-680
Classification Level Classification E-value
Superfamily E set domains 7.93e-31
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016547   Gene: ENSMPUG00000016650   Transcript: ENSMPUT00000016793
Sequence length 701
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896913.1:19720147:19777935:1 gene:ENSMPUG00000016650 transcript:ENSMPUT00000016793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGLEEDQEFDFDFLFEFNQSDEGPAAAPEHYSYASPGVSSALLPGSAQPSLPAPGHDLQ
ISAPGVPATAAGQPPGYGGAVDSGPSSYFLSSGHVRPNGAPALESPRIEITSYMGLHHGN
NQCFHDVEVEDILPGSRRPPSTATLSLPNLEAYRDPSCLSPASSLSSRSCNSEASSYESN
FSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACGLLGSPRHSPSTSPRTSVTEESWL
GARTSRPPSPCNKRKYGLNGRQPSCSPHRSPTPSPRSSPRVSVTDDTWLGNSTQYTSSAI
VAAINALSTDGSLELDGVPVKARKTTPDHCPSVALKVEPAGEDLGTTPPTAEFLPEEYPS
FQHVRKGAFCDQYLSVPQHPYQWARPRSPTAYGSPSLPALDWQLPSRSGPYELRIEVQPK
PHHRAHYETEGSRGAVKASAGGHPSVQLHGYLENEPLTLQLFIGTADDRLLRPHAFYQVH
RITGKTVSTTSHEAILSNTKVLEIPLLPENNMRAIVDCAGILKLRNSDIELRKGETDIGR
KNTRVRLVFRVHIPQPSGRTLSLQVASNPIECSQRSAQELPLVEKQSAASCPVLGGKKMV
LSGHNFLQDSKVIFVEKAPDGHHIWEMEAKMDRELCKPNSLVVEIPPFRNQRITSPVQVS
FYVCNGKRKRSQCQRFTYLPANGNALLLALSTENEPRGPFF
Download sequence
Identical sequences M3YYY7
ENSMPUP00000016547 ENSMPUP00000016547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]