SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016549 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016549
Domain Number 1 Region: 97-247
Classification Level Classification E-value
Superfamily HAD-like 8.8e-30
Family NLI interacting factor-like phosphatase 0.0025
Further Details:      
 
Domain Number 2 Region: 524-630
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000000093
Family DNA-repair protein XRCC1 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016549   Gene: ENSMPUG00000016652   Transcript: ENSMPUT00000016795
Sequence length 759
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896913.1:19913345:20008893:1 gene:ENSMPUG00000016652 transcript:ENSMPUT00000016795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGRAGPRPRALRARGLPSSPGTVLSVSRSVLLQLEGCSHPVVMKGLCAECGQDLTQLRSK
NGGQQVPLSTATVSMVHSVPELMVSSEQAAKLAREDQERLHRNRKLVLMVDLDQTLIHTT
EQHCQQMSNKGIFHFQLGRGEPMLHTRVRPHCREFLEKIARLYELHVFTFGSRLYAHTIA
GFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITV
KKYVYFQGIGDINAPSGSRESQARRKVNPSPRGADVPEQALSVRETEGRPGSGVEQSNGL
GKPTRELNGSASARGDWPLPGQEEERGSRPIARGPLTDGKGPPVCAPQPDRTLLEKRAAQ
GTAGGDLDFDLSSDSESDTQSLSDGESGEKRSLERPQGAHGAGKVVQRGGPPGPGGERPC
GEPAPGLHPDVQEEGERDGLCGLGGGSADRKEAETESQNSEQSGVTAGESLDQSVEEEDE
DEDDGDGDDHLVHLEDILARVHSDYYARYDRHLLGDSPEAPDIRKIVPELKSRVLADVVI
IFSGLHPTNFPVEKTREHYHATALGAKVLTQLALDPGSPNRATHLIAARAGTEKVRQAQE
CGQLHVVNPDWLWSCLERWDRVEEQLFPLREDYGRVQREDGPAAFPDRQGAPPAALFHPT
PVHPRAQAGPDVRIYDANTGKLIRKGAAGPGPPGSLAVHAEHSSFRVVQPPRQTLAQELP
DSRPGEQPGPSGRKRQPSMSETMPLYTLCKEDLESMDKE
Download sequence
Identical sequences M3YYY9
ENSMPUP00000016549 ENSMPUP00000016549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]