SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016587 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016587
Domain Number 1 Region: 43-106
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-17
Family LIM domain 0.0014
Further Details:      
 
Domain Number 2 Region: 224-287
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.62e-16
Family LIM domain 0.0011
Further Details:      
 
Domain Number 3 Region: 166-227
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.76e-16
Family LIM domain 0.002
Further Details:      
 
Domain Number 4 Region: 130-164
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000499
Family LIM domain 0.00074
Further Details:      
 
Domain Number 5 Region: 6-40
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000123
Family LIM domain 0.0024
Further Details:      
 
Domain Number 6 Region: 101-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000133
Family LIM domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016587
Domain Number - Region: 283-312
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0217
Family LIM domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016587   Gene: ENSMPUG00000016690   Transcript: ENSMPUT00000016833
Sequence length 341
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897211.1:1025321:1062306:1 gene:ENSMPUG00000016690 transcript:ENSMPUT00000016833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGSNMSNALANAVCQRCQARFAPAERIVNSNGELYHEHCFVCAQCFRPFPEGLFYEFEG
RKYCEHDFQMLFAPCCGSCGEFIIGRVIKAMNNNWHPGCFRCELCDVELADLGFVKNAGR
HLCRPCHNQEKAKGLGKYVCQRCHLVIDEQPLMFKNDAYHPDHFSCTHCGKELTAEAREL
KGELYCLPCHDKMGVPICGACRRPIEGRVVNALGKQWHVEHFVCAKCEKPFLGHRHYEKK
GLAYCETHYNQLFGDVCYNCSHVIEGDVVSALNKAWCVNCFSCSTCNSKLTLKNKFVEFD
MKPVCKRCYEKFPLELKKRLKKLSELAARKAHPKSVGLNSA
Download sequence
Identical sequences M3YZ27
ENSMPUP00000016587 XP_004779747.1.14098 ENSMPUP00000016587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]