SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016592 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016592
Domain Number 1 Region: 74-284
Classification Level Classification E-value
Superfamily PH domain-like 4.48e-24
Family Pleckstrin-homology domain (PH domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 895-1124,1154-1195,1446-1590,2090-2136
Classification Level Classification E-value
Superfamily ARM repeat 0.0000374
Family HspBP1 domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016592   Gene: ENSMPUG00000016695   Transcript: ENSMPUT00000016838
Sequence length 2180
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896989.1:7510229:7675945:-1 gene:ENSMPUG00000016695 transcript:ENSMPUT00000016838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFRGKVFKREASEFRKKRRTVRRINQEEIHRLGSQEKPRLLEPLDYETVIEELEKTYRN
DPLQDLLFFPSDDFSTATVSWDIRTLYSTVPEDAEHKAENLLVKEACKFYSSQWYVVNYK
YEQYSGDIRQLPRAEYKPEKLPSHSFEVDHEDADKDEDTTSHSSSKGGGAAGGTGVFKSG
WLYKGNFNSTVNNTVTVRSFKKRYFQLTQLPDNSYIMNFYKDEKISKEPKGCIFLDSCTG
VVQNNRLRKYAFELKMNDLTYFVLAAETESDMDEWIHTLNRILQISPEGPSQGRRSTELA
ELGLDSLDNSITCECTPEETESSENSLHPDFAKYLTETEETVKTTRNMERLNLFSLDPDI
DTLKLQKKDLLEPDSVIKPFEEKAAKRIMIICKALNLNLQGCVTENENDPITNIEPFFVS
VALYDLRDNRKISADFHVDLNHTAVRQMLSGSSVALENGNIDTVTPRQSEEPHIKGFPEE
WLKFPKQAIFSVSNPHSEIVFVAKIEKVLMGNIASGAEPYIKNPDSNKYAQKILKSNRQF
FSKLGKYRMPFAWAVRSVFKDNQGNVDRDSRFSPLYRQESSKISTEDLLKLVSDYRRADR
VSKTQTIPGSLDIAVDNIPLEHPNCVTSSFIPVKPFDVTAQLEPTVEVEEFIYDSTKYCR
PYRVYKNQIYIYPRHLKYDSQKCFNKARNITVCIEFKNSDEEGAKPVKCIYGKPGGPLFT
SAAHTAVLHHSQNPDFSDEVKIELPTQLHEKHHILFSFYHVTCDINAKANAKKKEMLETS
VGYAWLPLMKHDQIASQEYNIPIATSLPPNYLSFQDSASGKHSGSDIKWVDGGKPLFKVS
TFVVSTVNTQDPRVNAFFRQCQKREKDMSQSPTSNFIRSCKNLLNVEKIHAIMSFLPIIL
NQLFKVLVQNEEDEISTTVTRVLTDIVAKCHEEQLDHSVQSYIKFVFKTTACKERTIHEE
LAKNVTGLLKSNDSTTVKHVLKHSWFFFAIILKSMAQHLIDTNKIQLSRTQRFPESYQNE
LDNLVMVLCDHVIWKYKDALEETRRANHSVARFLKRCFTFMDRGFVFKMVNNYVSMFSSG
DLKTLCQYKFDFLQEVCQHEHFIPLCLPIRSANIPDPLTPSESTQELHASDMPEYSVTNE
FCRKHFLIGILLREVGFALQEDQDIRHLALAVLKNLMAKHSFDDRYRQPEKQAQIASLYM
PLYGMLLDNMPRIYLKDLYPFTVNTSNQGSRDDLSTSGGFHTQSAMKHANSVDTSFSKDV
LNSIAAFSSIAISTVNHADSRASLASLDSNPSTNEKSSEKTDNCEKVPRPLSLIGSTLRF
DKLDQAETRSLLMCFLHIMKTISEETLIAYWQRAPSPEVSDFFSILDVCLQNFRYLGKRN
IIRKIAAAFKFVQSTQNNGTLKGSNPSCQASGPLSQWMHTTSSHEGHKQHRSQTLPIIRG
KNALSNPKLLQMLDNTISSNSNEIDIVHHVDTEANIATEVCLTILDLLSLFTQIHQRQLQ
QSECQNSMMKRVFDTYMLFFQVNQSATALKHVFASLRLFVCKFPSAFFQGPADLCGSFCY
EVLKCCNHRSRSTQTEASALLYFFMRKNFEFNKQKSIVRSHLQLIKAVSQLIADAGIGGS
RFQHSLAITNNFANGDKQMKNSNFPAEVKDLTKRIRTVLMATAQMKEHEKDPEMLVDLQY
SLANSYASTPELRRTWLESMAKIHARNGDLSEAAMCYIHIAALIAEYLKRKGYWKMEKIC
TPPLLPEDIHPCDSYPLLTAPGGGSMFSMGWPAFLSITPNIKEEGAMKEDSGMQDTPYNE
NILVEQLYMCVEFLWKSERYELIADVNKPIIAVFEKQRDFKKLSDLYYDIHRSYLKVAEV
VNSEKRLFGRYYRVAFYGQGFFEEEEGKEYIYKEPKLTGLSEISQRLLKLYADKFGADNV
KIIQDSNKVNPKDLDPKYAYIQVTYVTPFFEEKEVEDRKTDFEMHHNINRFVFETPFTLS
GKKHGGVEEQCKRRTVLTTSHLFPYVKKRIQVISQSSTELNPIEVAIDEMSKKVSELNQL
CTMDDVDMIRLQLKVQGSVSVKVNAGPMAYARAFLEEANAKRYPDNQVKLLKEIFRQFAD
ACGQALDVNERLIKEDQLEYQEELRSHYKDMLSELSAIMNEQITYRDDPSKRGAERTCPL
VISRAALTVPTVSISASEEA
Download sequence
Identical sequences M3YZ32
ENSMPUP00000016592 XP_012917018.1.14098 ENSMPUP00000016592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]