SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016611 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016611
Domain Number 1 Region: 163-320
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 2.22e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 17-165
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.73e-66
Family DNA-binding protein LAG-1 (CSL) 0.0000107
Further Details:      
 
Domain Number 3 Region: 321-433
Classification Level Classification E-value
Superfamily E set domains 1.12e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016611   Gene: ENSMPUG00000016715   Transcript: ENSMPUT00000016858
Sequence length 487
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896988.1:1784300:1887419:-1 gene:ENSMPUG00000016715 transcript:ENSMPUT00000016858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPVVTGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCV
YLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDS
DKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRL
RSQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCS
VTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPC
PKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLEL
TGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDG
IIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNVSTNSTSVTS
SAATVVS
Download sequence
Identical sequences M3YZ51
ENSMPUP00000016611 ENSMPUP00000016611 XP_004762712.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]