SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016630 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000016630
Domain Number - Region: 170-270
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0134
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016630   Gene: ENSMPUG00000016734   Transcript: ENSMPUT00000016878
Sequence length 547
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896988.1:3032172:3130608:1 gene:ENSMPUG00000016734 transcript:ENSMPUT00000016878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVGPGPGRRSQSTRVGIGGCQGLGPAWQSRIREPEAGNLKYLVCKRKLESKKEALLIL
SKELDTCQQERDQYKLMANQLRERHQSLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQ
DRNKHLGEEIKELQQRLAEVQGDNKLLRMTIAKQRLGDEEIGVRHFAAHEREDLVQQLER
AKEQIESLEHDLQASVDELQDVKEERSSYQDKVERLNQELNHILGGHENRIIDVDALCME
NRYLQERLKQLHEEVNLLKSNIAKYKNALERRKNSKGQSKSSSSALTGVLSAKQVQDLLS
EDHGCSLPATPQSISDLKSLATALLETIHEKNMVIQHQRQTNKILGNRVAELEKKLRTLE
VSGLWSLPGGKDTILFSDPALPTIQRSRSPLLKFIEQPTENKANSEDGEAQRPERDESRA
ATEAWIAPEDAGRPAGRSPATQSHGNQCNPFHPSSPRRASEEEGINRLGGERMKLTEAEP
EGVRRASLGETQRHEPGTAPPGLASKGEVPTSCQGSFESSQAAAEASCPEDSKETPEGGG
MRSAVKT
Download sequence
Identical sequences M3YZ70
ENSMPUP00000016630 ENSMPUP00000016630 XP_004762736.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]