SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016638 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016638
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-55
Family Necap1 N-terminal domain-like 0.000000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016638   Gene: ENSMPUG00000016742   Transcript: ENSMPUT00000016886
Sequence length 274
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897020.1:4262631:4276712:1 gene:ENSMPUG00000016742 transcript:ENSMPUT00000016886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKL
EDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFN
VSLQDHFKWVKQESEISKESQDMDNRPKLDLGFKEGQTIKLSIGNITTKKGGASKPKTTG
AGGLSLLPPPPGGKVTIPPPSSVAISNHVTPPPIPKSNHGGSDADILLDLDSPAPVTTPA
SAPVSANNDLWGDFSTASSSVPNQAPQPSNWVQF
Download sequence
Identical sequences M3YZ78
ENSMPUP00000016638 ENSMPUP00000016638 XP_004766666.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]