SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016651 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016651
Domain Number 1 Region: 320-638
Classification Level Classification E-value
Superfamily TPR-like 1.42e-118
Family Tetratricopeptide repeat (TPR) 0.0000000000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016651   Gene: ENSMPUG00000016756   Transcript: ENSMPUT00000016900
Sequence length 640
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897020.1:4746404:4765590:-1 gene:ENSMPUG00000016756 transcript:ENSMPUT00000016900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMRELVEAECGGANPLMKLAGHFTQDKALRQEGLRPGPWPPGAPTTEAVSKPLGVASED
ELVAEFLQDQNAPLVSRAPQTFKMDDLLAEMQEIEQSNFRQAPQRAPGVADLALSENWAQ
EFLAAGDAVDVTQDYNETDWSQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTA
STDHWYDEYHPEEDLQHTASDFVAKVDDPKLANSEFLKFVRQIGEGQVSLESGAGSGRAQ
AEQWAAEFIQQQGTSEAWVDQFTRPVNTAALDMEFERAKSAIESDVDFWDKLQAELEEMA
KRDAEAHPWLSDYDDLTSASYDKGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFE
AAVQHDPKHMEAWQYLGTTQAENEQELLAISALRKCLELKPDNRTALMALAVSFTNESLQ
RQACETLRDWLRYTPAYAHLVVRGEEGAGGSGQGPSKRILGSLLSDSLFLEVKELFLAAV
RLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSE
EAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAM
SENIWSTLRLALSMLGQSDAYGAADARDLPTLLAMFGLPQ
Download sequence
Identical sequences M3YZ91
XP_012919040.1.14098 XP_012919041.1.14098 XP_012919042.1.14098 XP_012919043.1.14098 XP_012919044.1.14098 ENSMPUP00000016651 ENSMPUP00000016651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]