SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016710 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016710
Domain Number 1 Region: 396-678
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-90
Family Protein kinases, catalytic subunit 0.00000000141
Further Details:      
 
Domain Number 2 Region: 55-176
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.06e-25
Family PLC-like (P variant) 0.00000115
Further Details:      
 
Domain Number 3 Region: 271-338
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.27e-23
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000922
Further Details:      
 
Domain Number 4 Region: 195-264
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.48e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016710   Gene: ENSMPUG00000016815   Transcript: ENSMPUT00000016959
Sequence length 730
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:3287506:3305879:1 gene:ENSMPUG00000016815 transcript:ENSMPUT00000016959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVTCRAPGMAVLPTTGVRPPLLLHARPVTTTCDPLASSSASAVPSDSPTAGPGMAPFLR
IAFTSYELGSLQPADDASQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEG
RVIQIVLMRAAEEPMSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLEDVD
CKQSMRGEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQG
YKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVYNYMSPTFCDH
CGSLLWGLVKQGLKCEDCGMNVHHKCQKKVANLCGINQKLLAEALNQVTQRPSRKSETET
VGIYQNFERKSGVPGDIVPDSGTYGKIWEGSSRCNIENFTFHKVLGKGSFGKVLLAELKG
KKEFFAIKALKKDVVLIDDDVECTMVEKRVLALAWENPFLTHLFCTFQTKDHLFFVMEFL
NGGDLMYHIQDKGRFELYRATFYAAEIVCGLQFLHSKGIIYRDLKLDNVMLDQDGHIKIA
DFGMCKENIVGDKQASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHG
DDEDELFESIRVDTPHYPRWITKESKDILEKLLERDTSKRLGVSGNIKIHPFFKTINWTL
LEKRAVEPPFKPKVEQRVGKLLLEQSDGTYFRLCRPDGLNKAATENLSTNGYSFFFFXXX
XXXXXXXXXX
Download sequence
Identical sequences M3YZF0
ENSMPUP00000016710 ENSMPUP00000016710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]