SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016712 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016712
Domain Number 1 Region: 31-149
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-44
Family Dcp1 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016712   Gene: ENSMPUG00000016817   Transcript: ENSMPUT00000016961
Sequence length 600
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:3375471:3431603:-1 gene:ENSMPUG00000016817 transcript:ENSMPUT00000016961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSCPRLRLRRRGSAPEFKMESLSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCP
KANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNA
SLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEM
LSRAKDEYERNQMGDSNISSPGLQPSSQLSNLGSTETLEETPSGSQDKSAPSGHKHLTVE
ELFGTSLPKEQPVVVGLDSEEVERLPGDASQKETSSFLPFSFEQSGGAPQSENLGVHPAA
HHSVPPEVPTPVLITPASITQSGDKQTPGYAIPLRPVLSPTLPAEAPTAQVPPSLPRNTT
MIQAVKTTPRQRSPLLSQPVPELSHANLTATQSPFRAPLSVTNTAGTSLPSVDLLQKLRL
TPQHDQIQTQSLGKGAVAPSFSPAAGQLATPESFIEPPSKTAAARASASLSNMVLAPLQS
MQQNQDPEVFAQPKVLPSAIPVTGPTLVTATTMAVSSVLLSPSVFQQTVTRSADLERKAN
APSPLTVGTSENQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL
Download sequence
Identical sequences M3YZF2
XP_004738253.1.14098 ENSMPUP00000016712 ENSMPUP00000016712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]