SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016741 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000016741
Domain Number - Region: 114-223
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.00959
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016741   Gene: ENSMPUG00000016846   Transcript: ENSMPUT00000016990
Sequence length 1516
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:6393013:6444112:-1 gene:ENSMPUG00000016846 transcript:ENSMPUT00000016990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAGETEASPPTDASWESGGGGDDEMKQALPELESSPQNGGGGGLSIAEPGGGAGPEET
AAASAAPSVSHEQPQDSSEAGAAALLKGPEEPERPVRRSFQIPRKSREKKALFQPLTPGS
REFEDVLNILHSSYLEPTSVTNFNYKRACLIHNELLEKEFTEKRRELKFDGRLDKELSES
YAFLMVDRYQVQSICEKGLQVGQSKITILGSPSMGIYLSRYADLLQANPLEAGAVGDVVI
FKIMKGKIKSIYDPMGVKSLESILNKSALDPTPKHECHVSKNANRITSLLAYRAYELTQY
YFYEYSFDELRRRPRHVCPYAVVSFTYKDDIQTPKFVPSSRANSFNADRNTDKFNYTLWK
GQLLNKGKLLCYISLRSATRAFLPIKLPEKLDVETVMSIDHLKQKIPPALFYKETYLGPS
EVLKNGMYCSLYEVVEKTRIGSNMESLLQKLEKEKLVLVKPLGDRGYLFLLSPCQMVSPY
EHQTARSRVLHALFLFQEPRGVVTSQKGSTNATPQKRHESMTDVLKITQFLQFALIQCRK
EFKNINTINFHSVVEKYVNEFFKRGFGSGKREFIMFPYDSRLDDKKFLYSAPKNKSHIDN
CLHAYIFRPEMYQLPICKLKELFEENRKLQQFSPLSDYEGQEEEMNGTKMKFGKRNNSRG
ETIIPRKQKSSHSLDYDKDRVKELINLIQCRKKNVGGDSDTEDMRSKTVLKRKLEDLPEN
MRKLAKTSNLSENCHLYEGSPQPIGSLGHDADLRQQLQDTSNSGVADIHRLFNWLSETLA
NARHSDASLTDTVNKALGLNTDDAYEELRQKHEYELSSPPDKKEYEQPTCAKIESVHFKG
TQSPLLEVDTSLLKYPVAGSTGEAGMDHKLHLKEDPNLINMSNFEDCSLCPTVPIEHGFR
RQSKSNNVEETEIHWKLIPITGGNARSPEDQLGKHGEKQTPGMKSPEEQVVYLPPQEAFP
NDPRVISRQRSSDYQFPSSPFTDTLKGTTEDDVLTGQVVTVEEQCVPAAEPPTMSETTER
TVLGEYNLFSRKIEEILKQKNVSYVSRISTPIFSTQEKMKRLSEFIYSKTSKAGVQEFVD
GLHEKLNTIIIKASAKGRNLPPVSPNDSGSKIALNPLGKPVLPVSSSDFNNKQLLEPLCS
DTLKDTNSIEQHSSSALGLTEVEVNQPYHATELMVTSDHTVPGDTAREPVEKETTKSPSD
VNISAQPALSNFISQLEPEVFNSLVKIMKDVQKNTVKFYIHEEEESVLCKEIKEYLIKLG
NTECHPEQFLERRSKLDKLLIIIQNEDIAGFIHKVPGLVTLKKLSCVSFAGVDSLDDVKN
HTYNELFVSGGFIVSDESILNPEVITIENLKNFLTFLEELSTPEGKWQWKVHCKFQKKLK
ELGRLNAKALSLLTLLNVYQKKHLVEILSYHNCDSQTRNAPELDCLIRLQAQNIQQRHIV
FLTEKNIKMVSSYTDNGIVVASTEDFMQNFKNLVGYHNSITEENLPLLGANETLESQSDA
VLTLTPLELGVGISQH
Download sequence
Identical sequences M3YZI1
XP_004738279.1.14098 ENSMPUP00000016741 ENSMPUP00000016741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]