SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016747 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016747
Domain Number 1 Region: 155-306
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-35
Family DBL homology domain (DH-domain) 0.00064
Further Details:      
 
Domain Number 2 Region: 317-440
Classification Level Classification E-value
Superfamily PH domain-like 2.22e-19
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016747   Gene: ENSMPUG00000016852   Transcript: ENSMPUT00000016996
Sequence length 519
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:6465897:6647366:-1 gene:ENSMPUG00000016852 transcript:ENSMPUT00000016996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPCHFLSCSPSGREEFLQGNYALLSSENPVCRAPSQLGAGDSAWMRPERPMVWCCFFVR
AQRKRKQSTQDEDAVSLCSLDISEPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQR
SISFRSESRPDILAPRPWSRNAASSSTKRRDSKLWSETFDVCVNQMLPSKEIKRQEAIFE
LSQGEEDLIEDLKLAKKLPCLSSYDSYCSNQVAAKALLDHKKQDHRVQDFLQRCLESPFS
RKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEAINIIQGIVAEINTKTGE
SECRYYKERLLYLEEGQKDSLIDNSRVLCCHGELKNNRGVKLHVFLFQEVLVITRAVTHN
EQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFFRVSFKNGSQSQTH
SLQANDTFNKQQWLNCIRQAKETVLCAAGQAGALDSEGPFLNPAPRSQEPQGDTKLEQMD
QSDSESDCSMDTSEVSLDCERMEQTDSSGGNSRHIESNV
Download sequence
Identical sequences M3YZI7
ENSMPUP00000016747 ENSMPUP00000016747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]