SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016751 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016751
Domain Number 1 Region: 1-266
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.64e-60
Family BAR domain 0.00000000301
Further Details:      
 
Domain Number 2 Region: 443-597
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-27
Family Phosphotyrosine-binding domain (PTB) 0.0098
Further Details:      
 
Domain Number 3 Region: 242-337
Classification Level Classification E-value
Superfamily PH domain-like 1.95e-22
Family Pleckstrin-homology domain (PH domain) 0.00000209
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016751
Domain Number - Region: 584-630
Classification Level Classification E-value
Superfamily Gam-like 0.0353
Family Gam-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016751   Gene: ENSMPUG00000016856   Transcript: ENSMPUT00000017000
Sequence length 672
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:6935127:6963468:1 gene:ENSMPUG00000016856 transcript:ENSMPUT00000017000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQLYQAMLRIYDAQNELSAATHLTSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDEL
SSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEVFQIASNDHDAAINRYSRLSKKREN
DKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSE
NLNEQLEEFLTNIGTSVQNVRREMDNDVETMQQTIEDLEVASDPLYVPDPDPMKFPVNRN
LTRKAGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCE
DRRYCFQITSFDGKKSSILQAESKKDHEEWICTINNISKQIYLSENPEEIAARVNQSALE
AVTPSPSFQQRHESLRPAAQSRPPTARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDI
ISPVCEDQPGQAKAFGQGGRRTNPFGESGGGTKSETEDSILHQLFIVRFLGSMEVKSDDN
PDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQVTRLTFPLPSVVLYATH
QENKRLFGFVLRTSGGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASE
KQKEIERVKEKQQKELSKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESD
LGEEGKKRESEA
Download sequence
Identical sequences M3YZJ1
ENSMPUP00000016751 XP_004738292.2.14098 ENSMPUP00000016751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]