SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016761 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016761
Domain Number 1 Region: 7-79
Classification Level Classification E-value
Superfamily RING/U-box 9.42e-19
Family RING finger domain, C3HC4 0.0073
Further Details:      
 
Domain Number 2 Region: 138-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000763
Family B-box zinc-binding domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016761
Domain Number - Region: 181-270
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0105
Family Arfaptin, Rac-binding fragment 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016761   Gene: ENSMPUG00000016866   Transcript: ENSMPUT00000017010
Sequence length 551
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896923.1:2972463:2985261:-1 gene:ENSMPUG00000016866 transcript:ENSMPUT00000017010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENWKNCFEEELICPICLHVFVEPVQLPCKHNFCRGCIGEAWAKDSGLVRCPECNQAYN
QKPGLEKNLKLTNIVEKFNALHVEKPPAALHCVFCRRGPPLPAQKVCLRCEAPCCQSHVQ
THLQQPSTARGHLLVEADDVRAWSCPQHNAYRLYHCEAEQVAVCQYCCYYSGAHQGHSVC
DVEIRRNEIRKMLMKQQDRLEEREQDIEDQLYKLESDKRLVEEKVSQLKEEVRLQYEKLH
QLLDEDLRQTVEVLDKAQAKFCSENAAQALHLGERMQEAKKLLGSLQLLFDKTEDVSFMK
NTKSVKILMDRTQTCTGSSLSPPKIGHLNSKLFLNEVAKKEKQLRKMLEGPFSTPVPFLQ
SVPLYPCGVSSSGAEKRKHSTAFPEASFLETSSGPVGSQYGAAGTASGEGQSGQPLGPCS
STQHLVALPGGAQPVHSSPVFPPSQYPNGSATQQPMLPQYGGRKILVCSVDNCYCSSVAN
HGGHQPYPRSGHFPWTVPSQEYSHPLPPTPSVPQSLPGLAVRDWLDASQQPGHQDFYRVY
GQPSTKHYVTS
Download sequence
Identical sequences K7ZRL2 M3YZK1 U6CUS6
ENSMPUP00000016761 ENSMPUP00000016761 NP_001277179.1.62641 XP_004402038.1.74151 XP_004749427.1.14098 XP_019314819.1.44245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]