SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016774 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016774
Domain Number 1 Region: 545-715
Classification Level Classification E-value
Superfamily Sec7 domain 2.62e-55
Family Sec7 domain 0.0000363
Further Details:      
 
Domain Number 2 Region: 753-874
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-26
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016774   Gene: ENSMPUG00000016879   Transcript: ENSMPUT00000017023
Sequence length 1027
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896923.1:3172898:3187403:1 gene:ENSMPUG00000016879 transcript:ENSMPUT00000017023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGAMRFCSEGDCAISPPRCPRRWLPEGPVPQSPPASMYGSTGSLLRRVAGPGPRGREL
GRVTAPCTPLRGPPSPRVAPSPWAPSSPTGQPPPGARSSVVIFRFVEKASVRPLNGLPAP
GGLSRSWDLGGVSPPRPTPALGPGSNRKLRLEASTSDPLPAGGGSALPGSQGLIHGPPAQ
PQVGTDGLYSSLPNGLGGPSEHLAKLFLGPADTGLRNQGDTWSSPREVSSHAQKIARAKW
EFFYGSLDPPGSGAKPPEQAPPSPLGVGSGQGSGVAVGRAAKYSETDLDTVPLRCYRETD
IDEVLAEREEADSAIESQPSSEGPHSTARPPAPRPSPCLGPCPSLGSGNEDDEDEAGGEE
EVDDEVFEASEGARPGTRMPHPGPLKSPVPFLPGTSPSADGPDSFSCVFEAILESHRAKG
TSYTSLASLEALASPGPTQSPFFTFELPPQPPAPRPDPPAPAPLAPLEPDSGTSSAADGP
WTQRGEEEEAEAGAKQAPGREPPSPCRSEDSFGLGTAPLGSEPPLSQLVSDSDSELDSTE
RLALGSTDTLSNGQKADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKF
FVFTGMSLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPGALSSEDGAHTLTCAL
MLLNTDLHGHNIGKRMTCGDFIGNLEGLNEGGDFPRELLKALYSSIKNEKLQWAIDEEEL
RRSLSELADPNPKVIKRVSGGSGSGSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTP
RGKRGWKSFHGILKGMILYLQKEEYQPGKALSEAELKNAISIHHALATRASDYSKRPHVF
YLRTADWRVFLFQAPSLEQMQSWVTRINVVAAMFSAPPFPAAVSSQRKFSRPLLPSAATR
LSQEEQVRTHEAKLKAMASELREHRAAQLGRKARGKEAEEQRQKEAYLEFEKSRYGTYAA
LLRVKLKVGSEELDAVEAALAQAGSSEDGLPPAHSSPSPQANPSSQPRAQGPGSEPRTGA
SSGRWKL
Download sequence
Identical sequences M3YZL4
ENSMPUP00000016774 ENSMPUP00000016774 XP_004749435.1.14098 XP_012910042.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]