SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016813 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016813
Domain Number 1 Region: 340-461
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-22
Family Pleckstrin-homology domain (PH domain) 0.000000633
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016813
Domain Number - Region: 224-324
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00687
Family Synaptotagmin-like (S variant) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016813   Gene: ENSMPUG00000016917   Transcript: ENSMPUT00000017062
Sequence length 1262
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:11602475:11972269:-1 gene:ENSMPUG00000016917 transcript:ENSMPUT00000017062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAVQSYYEVFLKSDRVARMVQSGGCSANDSREVFKKHIEKRVRSLPEIDGLSKETVLSS
WMAKFDAIYRGEEDPRKQQARMTASAASELILSKEQLYEMFQNILGIKKFEHQLLYNACQ
LDNPDEQAAQIRRELDGRLQMADQIARERKFPKFVSKEMENMYIEELKSSVNLLMANLES
MPVSKGGEFKLQKLKRSHNASIIDMGEESENQLSKSDVVLSFSLEVVIMEVQGLKSLAPN
RIVYCTMEVEGGEKLQTDQAEASKPTWGTQGDFSTTHALPAVKVKLFTESTGVLALEDKE
LGRVILHPTPNSPKQSEWHKMTVSKNCPDQDLKIKLAVRMDKPQNMKHSGYLWAIGKNVW
KRWKKRFFVLVQVSQYTFAMCSYREKKAEPQELLQLDGYTVDYTDPQPGLEGGRAFFNAV
KEGDTVIFASDDEQDRILWVQAMYRATGQSHKPVPPTQVQKLNAKGGNVPQLDAPISQFS
GLKDADRAQKHGMDEFISSNPCNFDHASLFEMVQRLTLDHRLNDSYSCLGWFSPGQVFVL
DEYCARNGVRGCHRHLCYLRDLLERAENGAMIDPTLLHYSFAFCASHVHGNSQQMHVYLS
GLPPNTDPQGSKIPSPSEPEAKKDTKKESKKRKDYKAQANPEPKRPDGIGTVTVEEKERF
EEIKERLRVLLENQITHFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPQEEVKTVIR
KCLEQAALVNYSRLSEYAKIEGKKREMYEHPVFCLASQVMDLTIQNQKDAENVGRLITPA
KKLEDTIRLAELVIEVLQQNEEHHAEPHVDKGEAFAWWSDLMVEHAETFLSLFAVDMDAA
LEVQPPDTWDSFPLFQLLNDFLRTDYNLCNGKFHKHLQDLFAPLVVRYVDLMESSIAQSI
HRGFERESWEPVKSLTSNLPNVNLPNVNLPKVPNLPVNIPLGIPQMPTFSAPSWMAAMYD
ADNGSGTSEDLFWKLDALQTFIRDLHWPEEEFGKHLEQRLKLMASDMIESCVKRTRIAFE
VKLQKTSRSTDFRVPQSICTMFNVMVDAKAQSTKLCSMEMGQEFAKEWHQYHSKIDELIE
ETVKEMITLLVAKFVTILEGVLAKLSRYDEGTLFSSFLSFTVKAASKYVDVPKPGMDVAD
AYVTFVRHSQDVLRDKVNEEMYIERLFDQWYNSSMNVICTWLTDRMDLQLHIYQLKTLIR
MVKKTYRDFRLQGVLDSTLNSKTYETIRNRLTVEEATASVSEGGGLQGISMKDSDEEDEE
DD
Download sequence
Identical sequences M3YZQ2
ENSMPUP00000016813 ENSMPUP00000016813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]