SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016814 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016814
Domain Number 1 Region: 152-373
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-48
Family DBL homology domain (DH-domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 376-507
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-23
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016814   Gene: ENSMPUG00000016918   Transcript: ENSMPUT00000017063
Sequence length 790
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897020.1:5520508:5537252:-1 gene:ENSMPUG00000016918 transcript:ENSMPUT00000017063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTFVPPDECPFQGLVASRIETYGGRYQASKQGSADRLHSQVAPGLDPGRRRLHGYVPFA
KGSGQVRGVSPLKMQELEPEKKYGGPFGSGPPHSPKFKEVSKARQLEMRLHTFSMFGMPR
LPPEERRHWEIGEGSDSSLVTEKSWKELVPGHKEMSRELCHQQEALWELLTTELIYVRKL
KIMTNLLTAGLLNLQRVGLLTEVSAEILFGNVPSLIRAHKSFWEEVLGPTLRETRASGQP
LDPVSLQNGFLTFSQRFQPYVQYCLQVKRTMAYAREQQDNNPLFHAFVQWCEKHKLAGRQ
MLGDLLIKPHQRVTKYPLLLQAVLKRSPEAHVQEALSAMIAAVESFLRHINQLVHRSEEQ
ESLVAAARRIGPYDVLEPSSEEVQKNLRPFCTLDLTSPMLGVASEYIRQLLLEGPVRVKE
GREGKLDVYLFLFSDMLLVTKPQRKLNKAKVIRPPLMLEKLVCRPLRDPNSFLVIHLTEF
DCVSSALIVQCPSATDRAQWLEKTQQAQVTLQKLKAEEYVQQKRELLALYRDQDQESPGT
RPSSPSLEGSQSSAEGRTPEFSTIIPHLVVTEDTDEDSPLVPDDTSDSGYGTLIPGSPKG
PYHLSRLRPQALRRDPRLIFSTLDLRDVPLRPQPPNPQAPQRRSAPELPREVIQRGSSLP
RGDPPTWSEEEDRTSVGGNVVAETLHRAQLRGKLPPSPTHTDSAGESPWESSGDEEEESL
FLGTGCTPHSRALRAEDMLREIREDLASQRIEGIPELGNSRPRKLTRGQLQRMRGSCIVQ
LDTPMSVSEV
Download sequence
Identical sequences M3YZQ3
XP_004766780.1.14098 XP_004766782.1.14098 XP_004766783.1.14098 XP_004766784.1.14098 XP_012919058.1.14098 ENSMPUP00000016814 ENSMPUP00000016814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]