SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016816 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016816
Domain Number 1 Region: 406-594
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.07e-59
Family DNA polymerase beta-like 0.0000000192
Further Details:      
 
Domain Number 2 Region: 257-348
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 5.76e-28
Family DNA polymerase beta, N-terminal domain-like 0.0000105
Further Details:      
 
Domain Number 3 Region: 350-404
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 3.43e-18
Family DNA polymerase beta-like, second domain 0.0000987
Further Details:      
 
Domain Number 4 Region: 59-151
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000008
Family BRCT domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016816   Gene: ENSMPUG00000016920   Transcript: ENSMPUT00000017065
Sequence length 595
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896923.1:3905480:3916264:1 gene:ENSMPUG00000016920 transcript:ENSMPUT00000017065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVALIKPKTIRPGSGHTSMDPGGILKAFPKRRKIHASPSSKALVKKPKQEGGEEAGEWL
SSLRAHVVPSGIGRARAELFEKQITQYGGQICAAQAPGVTHIVVDEGMDCERVLRLLRLP
QLPQGAQLVKSTWLSLCLQEKRLVDTAGFNIYIPNSRYLDQPQLSKADQDSSVPPGAQEA
VLRTALSPPRPPTRPVSPPWRTEEAPSTQAQPDCDDETSDGEETQVSAADLEALISGHCS
PSLEGDAEPIPAPKGLDKWVCAQPSSQKAVNYNPHITEKLEVLAKAYSVQGDKWRALGYA
KAINALKSFHKPVTSYQEAFSIPGIGKRMAEKIVEILESGHLRKLDHISESVPVLELFSN
IWGAGTKTAQMWYQQGFRTLEDIRDQASLTSQQAIGLKHYEDFLERIPREEATEIEQTVR
EAAQAFSPGLLCVACGSYRRGKASCGDVDVLLTHPDGRSHQGIFNPLLDSLRRQGFLTDD
LVSQEENGQQQKYLGVCQLPGPGRRHRRLDIIIVPYSEFACALLYFTGSAHFNRSMRALA
KTKGMSLSEHALSTSVVRDTHGLKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW
Download sequence
Identical sequences M3YZQ5
ENSMPUP00000016816 ENSMPUP00000016816 XP_004749498.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]