SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016830 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016830
Domain Number 1 Region: 162-225
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000273
Family LIM domain 0.062
Further Details:      
 
Domain Number 2 Region: 222-289
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000143
Family LIM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016830
Domain Number - Region: 285-308
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00351
Family LIM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016830   Gene: ENSMPUG00000016934   Transcript: ENSMPUT00000017079
Sequence length 844
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:13196965:13347880:-1 gene:ENSMPUG00000016934 transcript:ENSMPUT00000017079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTVMPLEMEKTVSKLMFDFQRNSTSDDDSGCALEEYAWIPPGLKPEQVHQYYSCLPEEK
VPYVNSPGEKLRIKQLLHQLPPHDNEVRYCNSLDEEEKRELKLFSNQRKRENLGRGNVRP
FPVTMTGAICEQCGGQINGGDIAVFASRAGHGVCWHPPCFICTVCNELLVDLIYFYQDGK
IYCGRHHAECLKPRCAACDEIIFADECTEAEGRHWHMKHFCCFECETVLGGQRYIMKEGR
PYCCHCFESLYAEYCDTCAQHIGIDQGQMTYDGQHWHATETCFCCAHCKKSLLGRPFLPK
QGQIFCSRACSAGEDPNGSDSSDSAFQNARAKESRRSAKIGKNKSKTEEPMLNQHSQLQV
SANRLSADVDPLSLQMDMLSLSSQTPSLNRDPIWRSRDEPYHYGNKMEQNPSQSPLQLLS
QCNIRTSYSPGGQGAGAQPDMWAKHFSNPKRSSSMAMKGHGGSFMKECREDYYPGRLRSQ
ESYSDMSSQSFSETRGNIPVAKYEEEEEEEGGIATQQCRTRHPISSLKYTENMTPTEQTP
PGSMESLALSNATGLSADGGAKRQEHLSRFSMPDLSKDSGMNVSEKLSNMGTLNSSMQFR
SAESVRSLLSAQQYQEMEGNLHQLGNPIGYRDLQSHGRLHQSFDFDGGMASSKLQGQEGM
RIQPMSERTRRRSTSRDDGRRFRPHRSRRSRRSRSDNALHLASEREAISRLKERPPLRAR
EDYDQFMRQRSFQESLGQGSRRDLYGQCPRTVSDLALQNAFGERWGPYFAEYDWCSTCSS
SSESDNEGYFLGEPIPQPARLRYVTSDELLHKYSSYGLPKSSTLGGRGQLHSRKRQKSKN
CIIS
Download sequence
Identical sequences M3YZR9
ENSMPUP00000016830 ENSMPUP00000016830 XP_004738361.1.14098 XP_004738362.1.14098 XP_004738363.1.14098 XP_012909015.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]