SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016839 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016839
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000122
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016839   Gene: ENSMPUG00000016943   Transcript: ENSMPUT00000017088
Sequence length 125
Comment pep:novel scaffold:MusPutFur1.0:GL896899.1:14972792:15023356:-1 gene:ENSMPUG00000016943 transcript:ENSMPUT00000017088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRVIQKKNHWTSKVHECTVKRGPQGELGVTVLGGAENGEFPYVGAVAAAEAAGLPGGGE
GPRLGEGELLLEVQGIRVSGLPRYDVLGVIDSCKEAVTFKAVRQEGKLHCRKFRRNGNGN
GKLKQ
Download sequence
Identical sequences M3YZS8
ENSMPUP00000016839 ENSMPUP00000016839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]