SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016879 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016879
Domain Number 1 Region: 795-999
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.5e-48
Family DBL homology domain (DH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 1033-1230
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.49e-45
Family BAR domain 0.002
Further Details:      
 
Domain Number 3 Region: 1534-1594
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-17
Family SH3-domain 0.0000275
Further Details:      
 
Domain Number 4 Region: 260-324
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-17
Family SH3-domain 0.001
Further Details:      
 
Domain Number 5 Region: 158-220
Classification Level Classification E-value
Superfamily SH3-domain 5.78e-16
Family SH3-domain 0.00088
Further Details:      
 
Domain Number 6 Region: 1298-1374
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000236
Family SH3-domain 0.00000817
Further Details:      
 
Domain Number 7 Region: 20-78
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000735
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 8 Region: 85-142
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000121
Family SH3-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016879   Gene: ENSMPUG00000016984   Transcript: ENSMPUT00000017129
Sequence length 1597
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896923.1:5221327:5318100:1 gene:ENSMPUG00000016984 transcript:ENSMPUT00000017129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRTGADANSACCCKNMEAGSVVRAIFDFCPSVSEELPLFVGDIIEVLAVVDEFWLLGKK
EDVTGQFPSSFVEIVTIPSLKEGERLFVCICEFTSQELNSLPLHRGDLVILDGAPMASWL
QGRSCWGTRGFFPSSCVRELCLSSQSRRWHSQSALLQIPDYSMGQARALMGLSAQLDEEL
DFREGDVITIIGVPEPGWFEGELDGRRGIFPEGFVELLGPLRTVDELASSGNHNDCIING
EKETPAGEEERGPEEDEDQPGTYGIALYRFQALEPNELDFEVGDKIRILGTLEDGWLEGL
LKGRTGIFPYRFVKLFSKTRAEETVGLPQESSPAETADTSLGCSENSLVVEGKRPGSPEY
STEKSHCAISETSASPQEHLTSEYEVNKTSCQDEGTSGEPPRSPSLGHEQPLAKDSSAED
PSEIVNGVSSQPQVPFPPRWQKNQCYSAAGGGHLSSEQHADPLPFDARTKEDFSLPPRGM
ASPPKTLQKPVPPPHGGSCLLAPPAIRPSQLSSALQGLVRCARKHHASKDNPSSFCSAPE
RSGVKPGLPDKVFAAEEMALLQGEGDTDLDSKLTQQLIEFEKSLSGPGIEPERILRHFSI
TDFNSEKDVVRGSSKPITQQELPERRKARRPPPPRPCTPASASPHVLVDQNLKPELPLAM
RPSRPAPLPPSAQQREAPTSPRLLPWTGPSCETPEKESPESVDQTLDQTSQCPLVLVRVQ
EMEQDSDVGSRAQEELNLMLDEKQDEPLRAETLEDLEFYDSNIESLNMELQQLREMTLLS
SQSSSPVAPPGSVYTENPEQRMLEKRTKVIEELLQTERDYVRDLEMCIEHIMVPLQQAQI
PNIDFEGLFGNMQMVIKASKQLLADLEISDAVGPVFLDHRDELEGTYKVYCQNHDEAISL
LEIYEKDEKIQKHLQDSLADLKSLYTEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNS
TPESHPDKVPLTSAVLAVKEINVNINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIK
KSNRVSSHLKHLTGFAPQIKDEAFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKV
VAAVSMWDVCMEKGHRDLEQFEKVHRYISDQLFTNFKERTERLVISPLNQLLSMFTGPHK
LVQKRFDKLLDFYNCTERAEKLKDKKTLEELQSARNNYEALNAQLLDELPKFHQYARGLL
TNCVHGYAQAHCDFVRRALEQLQPLLSLIKVAGREGNLIAIFHEEHSRVLQQLQVFTFFP
ESLPASRKPFERKTMDRQSARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAA
QDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNARRSHSDASVGS
HSSTESELGSSSPRFPQQNSSSTLTFNPSSMAVSFTSGSCQKQPQDATSLKELDQEALSA
SLNLGCSESSPSRCPTDPDPSSQPRSWDLPEAARDIHPPAPALRSCRNSRRPETVGYSLQ
GRNGQGKDLMRGCTRTSQSLEDKNEEPESREAEGNQVYFAVYTFKARNPNELSVSANQRL
KILEFKDVMGNTEWWLAEVNGKKGYVPSNYIRKAEYT
Download sequence
Identical sequences M3YZW8
ENSMPUP00000016879 ENSMPUP00000016879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]