SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016914 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016914
Domain Number 1 Region: 32-391,432-458
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.02e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016914   Gene: ENSMPUG00000017020   Transcript: ENSMPUT00000017165
Sequence length 581
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896923.1:6598239:6628650:1 gene:ENSMPUG00000017020 transcript:ENSMPUT00000017165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARGPGLSRALGASPCPAWRRAHWGPKGHLKPEYNAVVIGAGHNGLVAAAYLQRLGVDT
AVFERRPVIGGAAVTEEIIPGFKFSRASYLLSLLRPQIYTDLELKKHGLKVHLRDPYSFT
PMLEEGLGNKVPRSLLLGMDMAENQKQIAQFSRKDAQAFPKYEAFMNRMALAIEPLLDAA
PVDTEAFHRGSLLQRLQALSKLKPLLQAGRVLGAQLPQYYQVLTAPITKVLDQWFESEPL
KATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGVQGAWGYVQGGMGALSEAIMSSAMA
HGASVFTEKTVTKVLVSNEGRAQGVVLQDGSEVRSRVVLSNASPQATFLKLTPQEWLPKE
FVERISQLDTKSPVTKINVAVDRLPDFLAAPNAPGGQPRPHHQCSIHLNCEDTLLLHQAF
QDAVDGLPSHRPMIELCIPSALDPTLAPPGCHVISLFTQYTPYTLAGGKVWDEQERSAYA
DKVFDCIEAYAPGFKSSVVGRDILTPPDLERIFGLPGGNIFHCAMTLDQLYFARPVPLHS
SYRCPLRGLYLCGSGAHPGGGVMGAAGRNAAQVVFRDLKSM
Download sequence
Identical sequences M3Z003
XP_004749583.1.14098 ENSMPUP00000016914 ENSMPUP00000016914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]