SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016923 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016923
Domain Number 1 Region: 49-124
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000471
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 139-181
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000157
Family Hairy Orange domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016923   Gene: ENSMPUG00000017029   Transcript: ENSMPUT00000017174
Sequence length 412
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:28204125:28210999:1 gene:ENSMPUG00000017029 transcript:ENSMPUT00000017174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERIPSAQPPPACLPKAPGLEPGDLPGMDFAHMYQVYKSRRGIKRSEDSKETYKLPHRLI
EKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIA
LQSGLQAGELSGRNVEAGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVS
ELLQGGTSRKPSDPVPKAMDFKEKPSSLAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTD
TDSGYGGESEKGDLRGEQQYFKSDHGRRFTMGERIGVIKQESEEPPTKKSRMQLSDDEGH
FTGSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAA
ALTSFMNPDKISAPLLMPQRLPSPLPSHPAIDSSALLQALKQIPPLNLETKD
Download sequence
Identical sequences M3Z012
XP_004738474.1.14098 ENSMPUP00000016923 ENSMPUP00000016923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]