SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016950 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016950
Domain Number 1 Region: 273-336
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000516
Family LIM domain 0.041
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016950
Domain Number - Region: 332-359
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00249
Family LIM domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016950   Gene: ENSMPUG00000017058   Transcript: ENSMPUT00000017203
Sequence length 363
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:31636299:31694323:1 gene:ENSMPUG00000017058 transcript:ENSMPUT00000017203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKVAKDLKKGVQKMSLGQQQSARGVPCLKCKGTCSGFEPHPWRKICKSCKCSHEDHCFN
SELEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEW
APPGVTQKLGLQYMELIPKEKQPVTGTEGAYYRRRQLMHQLPIYDQDPSRCRGLLENEVK
VMEDFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGPETTAPTTNGSIGDPSKEYV
CEFCKEVAPADSPVVYADRAGYSKQWHPTCFLCVKCSEPLVDLIYFWKDGAPWCGRHYCE
SLRPRCSGCDEIIFSEDYQRVEDLAWHRKHFVCEGCEQQLSGRAYIVTKGQLLCPTCSKS
KRS
Download sequence
Identical sequences M3Z039
ENSMPUP00000016950 ENSMPUP00000016950 XP_004738481.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]