SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016952 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016952
Domain Number 1 Region: 192-332
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.46e-32
Family Synaptotagmin-like (S variant) 0.062
Further Details:      
 
Domain Number 2 Region: 1032-1165
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.44e-21
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Domain Number 3 Region: 58-118
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000124
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016952   Gene: ENSMPUG00000017060   Transcript: ENSMPUT00000017205
Sequence length 1205
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896963.1:551941:933376:-1 gene:ENSMPUG00000017060 transcript:ENSMPUT00000017205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLYGIDSMPDLRRKKTLPIVRDVTLAARKSGLSLAMVIRTSLNNEELKIHVFKKTLQALI
YPMSSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEKCQDLLNADCLQ
RAAEKSSKHGAEDKTQTIIMAMKERMKIREKNRPEVFEVIQEMFQISKEDFVQYTKAAKQ
SVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKTIFGNLNPVWDE
KFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRTLSGEMDVWYNL
EKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVKSNGGVKIPEVK
GEEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPGVPAVMSTLLANIN
AFYAHTTVSTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYRENFPASNAERL
QDLKSTVDLLTSITFFRMKVLELQSPPKASMVVKDCVRACLDSTYKYIFDNCHELYSQEF
SKKQDIPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQFPQELNMGKISAEIM
WTLFAQDMKYALEEHEKQRLCKSTDYMNLHFKVKWFYNEYVRELPAFKDAVPEYSLYFPE
FYLTLLKNNEVVGGESLLGGIKKEKKKNFFNTEDHKLFMQEALIMFNACSQEFKLLLGPA
FLLSFLGSPVYTKSSFNLFYSQKLALSYPYFSIVDQLILPCNKQNTCRRNKSMLSQNSRL
ILFMVSLQLDPEASTILKELQVKLSGVLDELSITYGESFQLIIEECIKQMSFELNQMRTN
GNAASNKNSAAMNAEIVLRPLMDFLDKTLSLSAKICEKTVLKRVLKELWKLVLNKIEKQI
VLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMIREDAKGLTPRQCAIMEVVLATIKQYFHA
GGNGLKKNFLEKSPDLQSLRYALSLYTQTTDALIKKFIDTQTSQSHEGLGVYISANQNRK
PRKSEGSHPSKDSVGQISVHVDITATPGTGEHKVTVKVIAINDLNWQTTAMFRPFVEVCI
LGPNLGDKKRKQGTKTKSNTWSPKYNETFQFILGNENRPGAYELHLSVKDYCFAREDRII
GMTVIQLQNIAEKGSYGAWYPLLKNVSMDETGLTILRILSQRTSDDVAKEFVRLKSETRS
AEESA
Download sequence
Identical sequences M3Z041
ENSMPUP00000016952 ENSMPUP00000016952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]