SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016976 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016976
Domain Number 1 Region: 306-512
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.23e-66
Family DNA polymerase beta-like 0.000000024
Further Details:      
 
Domain Number 2 Region: 153-244
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 7.72e-29
Family DNA polymerase beta, N-terminal domain-like 0.000009
Further Details:      
 
Domain Number 3 Region: 246-304
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 1.6e-17
Family DNA polymerase beta-like, second domain 0.0000556
Further Details:      
 
Domain Number 4 Region: 39-126
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000671
Family DNA ligase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016976   Gene: ENSMPUG00000017084   Transcript: ENSMPUT00000017229
Sequence length 513
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896923.1:8375131:8417873:-1 gene:ENSMPUG00000017084 transcript:ENSMPUT00000017229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPTNPLQMVHLGPRKKKPRQMGASMVCPSHDIKFQDLVLYILEKKMGTTRRAFLMELA
RRKGFRVEDELSDSITHIVAENNSGSEVLEWLQGQNHKVSSQLELLDVSWLIESMAAGTP
VETTGKHQLVKRDYSANPNPELQKTPPLVIKKISQYACQRRTTLNNYNQIFTDAFEVLAE
NYEFRENEVFCLAFMRAASVLKSLPFTIISMKDTEGIPCLEDKVKCVIEEIIEDGESSEV
KAVLNDERYQSFKLFTSVFGVGLKTSEKWFRMGYRTLNKIKLDKTLKFTPMQKAGFLYYE
DLVSCVTRAEAEAVGMLVKEAVWAFLPEAFVTMTGGFRRGKKIGHDVDFLITSPGSTDED
EEQLLPKVINLWERKGLLLYCDLVESTFEKLKLPSRKVDALDHFQKCFLILKLHHQRVDS
GKCSQQEGKTWKAIRVDLVMCPYERRAFALLGWTGSRQFERDLRRYATHERKMILDNHAL
YDKTKKIFLKAESEEEIFAHLGLDYIEPWERNA
Download sequence
Identical sequences M3Z065
ENSMPUP00000016976 ENSMPUP00000016976 XP_004749647.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]