SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016977 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016977
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000428
Family THAP domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016977   Gene: ENSMPUG00000017085   Transcript: ENSMPUT00000017230
Sequence length 255
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896963.1:2207395:2222535:1 gene:ENSMPUG00000017085 transcript:ENSMPUT00000017230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARCVAAHCGNTTKSGKSLFRFPKDRAVRLLWDRFVRGRRADWYGGNDRSVICSDHFAP
ACFDVSSVIQKNLRFSQRLRLVAGAVPTLHRVSAPAPKGEEEGEHAGGPEKGGEPQAGRQ
AEAAPRPASCTLLRARKRAAPSQITCENEVKQTQVPANNLSYGVTSVPTHCEDGPVHKST
QMSLKRPPHRSVGIQAKVKVFGKQLCNSTTQTEGLQSRSASVFDIYSSDPDADWDVKSEQ
SDLSYIAVQVKEESC
Download sequence
Identical sequences M3Z066
XP_004758377.1.14098 ENSMPUP00000016977 ENSMPUP00000016977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]