SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016987 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016987
Domain Number 1 Region: 846-864,900-1006
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000237
Family PLC-like (P variant) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016987   Gene: ENSMPUG00000017095   Transcript: ENSMPUT00000017240
Sequence length 1422
Comment pep:novel scaffold:MusPutFur1.0:GL896923.1:8660609:8764135:-1 gene:ENSMPUG00000017095 transcript:ENSMPUT00000017240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEDNSAEENVDKHLQKDLDEEENQNIIETLRGKVREKLKNAKINQDEKSSPQLLVDENM
YQWSKMEVSLDEGLWFFMLSGEEGSAMGRCSEQRSVNDSYPKHFLLGDNLQNFAKGQDED
FMEEIIFPDLLEVKAAEYVDDQEQIKKQQANIFVPSSSPVVNQRKLPKGMIPRILEDEGF
YIQRKPRIYKKTCNKMENRLLTLEKGKCWFEESGEIMSLPSPIRQSWNFRLNTSKGSLNP
ALKTIYRKAVKPDLESSIRNKMEGQREMYQLDLNIVGLQFSHHPLFNQEQVLCARLLQLY
ECFQDRQQQNLPQLLYEKLKALTDATKLANENLERSQLTKKSLQDYYWQISNTKQLYDLE
REKDFSLLHSILRTWKQIKSLRQQQGFTSTSVKLQFQRIKMNKCNEQNQEELLEMSEAEK
ETEGKALKNGEKQESFSYLASELGETDIERLKPITLMPHLSFTAELTNLSACSLHEQKRR
AKIQKLKYFIKILYNNKQVSCTSVSPLQFDFKVMFQQIFNIQLIYWPETICLEVYEISKR
TSLLAKLYLPLPNNTELKSKTVLEYVEFSSDELVIPACGEVGSNVPFLLEGNETEEICLL
TSGKLSYSLSWALDENGIPLTPMSQSLRSAYCSVLRNVDARGVPGIPWLINAQKLFEWAN
EVKIDPNDPEYSDLMEFIMYMKHKGQDIPKYFRLEQLQDEFNFVSEEEMKKSKRFQLLQL
RNAGQLDIFLLQQIPLYDKDIPDLVFQEYESQIEKDISISDVNSIIAQRINSANFLKKMR
RLIMKRIVKVSKFNLSDVVADYEEIVSASQLTHAVCKLVERRRQLKPQRKERKKVAAQTI
CDGDIKILVRILRAYNIPTRNTTGTRALDLPTYLKSSISRLRHKETIKSVASDEILNEDT
VQPFVEVSFQHTVYQTSTASGSHPCWNEEIKVDFISPGHDYSFSSLSKIKDNIYINIFDE
MIIEKHEDPYFKSCSSHSHVRKNWLGSIVFPFSALLQQSEISGTFQVNIPPVLLGYTWSK
TYVSPKEDFNGQNLKECTFLNIFATIEPQISHVTYNPELDKFSDQTDVLERAQIFKKTCK
IMFPNRRITTTVFNSEGIQILVTRYIKALNPPQQLLDMFLHDSNATLDLIARFVSLIPVV
PDILDENDGFDIWMTSERCISLAVGNKEEHAILLCNFFLYFGKKALVLLGTSMLEGQVAY
VLTQETDEFLLWNPLTGQCHKQIDPFCPLQSVDCLFDDGNVWFNIQQNNTPMAVHFDYSK
ESFWKQLLPKNFQGTKAHTIQPEEIIYCETNKSMIEDLKNRIERTLKCKMMEWRPKQPTR
WNRQCTYILRKILPKLELSTGSFVSSEEESEFERLLQFYLVTGFPIQMPYTDVQSIIDAV
YQTGIHSSEFPQTEFALAVYIHPYPNNVLSVWVYLVSLARHQ
Download sequence
Identical sequences M3Z076
ENSMPUP00000016987 XP_004749670.1.14098 XP_004749671.1.14098 XP_004749672.1.14098 ENSMPUP00000016987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]