SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016994 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016994
Domain Number 1 Region: 112-126,177-417
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-66
Family Nuclear receptor ligand-binding domain 0.0000224
Further Details:      
 
Domain Number 2 Region: 43-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.65e-28
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016994   Gene: ENSMPUG00000017103   Transcript: ENSMPUT00000017248
Sequence length 417
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896963.1:3470031:3475449:1 gene:ENSMPUG00000017103 transcript:ENSMPUT00000017248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WAHCPSASSSMAAAGPATVAASRKESPGRWGLGDQPAGVGPSLQCRVCGDSSSGKHYGIY
ACNGCSGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQEGMNQDAVQNER
QPRSTAQVRLAGMESDAETRLEPLVAPLAPAGPSPRDPMPVSAARALGPGALTPPGHHHF
LTSLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVK
WAKNLPVFSNLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPQASTAGSSQGRL
ALAGAESRILQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVML
SQHSKAHHPSQPVRFGKLLLLLPSLRFITSERVELLFFRKTIGNTPMEKLLCDMFKN
Download sequence
Identical sequences M3Z083
ENSMPUP00000016994 ENSMPUP00000016994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]